KEGG   Hydrogenobacter thermophilus: Hydth_1300Help
Entry
Hydth_1300        CDS       T02106                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
hte  Hydrogenobacter thermophilus
Brite
Enzymes [BR:hte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hydth_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M Ribosomal_L7Ae
Motif
Other DBs
NCBI-ProteinID: ADO45688
UniProt: D3DIV9
LinkDB All DBs
Position
complement(1190768..1191865)
Genome map
AA seq 365 aa AA seqDB search
MIDAQIVKEALKKNKVRTEVFKDIEYLRFTDDYKDIPRGTAIFKDFVVWGYPHIGRIFQL
TTGLPEQFNAPVWVEEKVDGYNTRIFSYKGEIYTLTRGGYICPFTTDRVREFISEKFFEE
NPHLVLCAEVAGPENPYVEEFPPYIQEDIAFFVFDIMKKGEQGFLPYREKLRIIDKYGLP
HVEMFGRFELTQIEEIKRLLKKLNQEKREGVVFKEDAERDKRVKYITSYANINDIKVTSL
NMLGLPADYYTNRLLRLALFIEEEQVEKNESLYKEIGEAFLEGIFKACQMVRSEGKVYRT
FRCRFNKKENALLFLEQMKHASAHIQIAERSLEKKGRYYLLEFDKVFLNMTGLLGHLLKG
GSVID
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgcacagatagtcaaagaagcactgaagaaaaacaaggtaagaacggaagtt
tttaaggatatagagtacctcagattcaccgatgactacaaagacatacccagaggtact
gccatctttaaggactttgtggtgtggggctacccacacataggaagaatatttcagctc
acaactggccttccagagcagtttaatgcacctgtatgggtagaggagaaggtggacgga
tacaacactcggatattctcttacaaaggagagatttacactttgacaaggggtggatac
atatgccccttcaccactgacagagtgagagagtttataagtgagaagttctttgaagaa
aatccccatcttgtcctgtgtgcggaggtggcaggtccagaaaatccctatgtggaggag
ttccccccatacatccaagaagacatagccttctttgtctttgatattatgaaaaaggga
gagcagggctttttaccgtacagggaaaagctcaggattatagacaaatacggacttcct
catgtggagatgtttggaaggtttgagctgacgcagatagaggagataaagcgcctcctg
aaaaagctcaaccaagagaaaagagagggggttgtgtttaaagaggatgctgagcgcgat
aaaagggtaaagtacataaccagctatgccaacatcaacgacataaaggtgacatcccta
aacatgctgggtctaccagcagattactataccaatagacttttgagactggcactcttt
atagaagaagaacaggtcgaaaaaaatgaaagcctctataaggagataggagaagccttt
ctggagggcatattcaaggcatgtcagatggtgaggtccgaaggaaaggtttacagaacc
ttcagatgtaggttcaacaaaaaggaaaatgcccttctctttcttgaacagatgaaacat
gcttctgcacatatccagattgccgaaaggtcgttggagaagaaaggcagatattacctg
ctggagtttgacaaagtttttctcaacatgactggtcttttgggacaccttctaaaaggt
gggtctgtaatagattag

DBGET integrated database retrieval system