KEGG   Hydrogenobacter thermophilus: HTH_0307Help
Entry
HTH_0307          CDS       T01167                                 

Gene name
stpK
Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
hth  Hydrogenobacter thermophilus
Brite
KEGG Orthology (KO) [BR:hth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hth01001]
    HTH_0307 (stpK)
Enzymes [BR:hth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HTH_0307 (stpK)
Protein kinases [BR:hth01001]
 Serine/threonine kinases: Other
  Bacterial family
   HTH_0307 (stpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-ProteinID: BAI68774
UniProt: D3DG22
LinkDB All DBs
Position
complement(312571..313386)
Genome map
AA seq 271 aa AA seqDB search
MDSTEEKNIILGTYQILSLLGRGTFGEVYKVRVLRGRYRGKMMALKVARNAEVLPYLWRE
VQTLLLFNHPHIISLQSYLYKKDRGELYVLYELMDVGDLKDYVVSNGKLSEENALKVLLH
VAKGLEFLHSRGYIHGDVKPENIFGKRVLRDVVWKLGDFGLVRIRGSESIIDVKGTAGYI
APEVFRGEIHRSSDIFSLGCVLHFMLTGRDPFECEDRKEKLKRNKEGACTIEDGLSERIK
TLLHIMLSKDPTKRFRTAKELIEYMIRERLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggatagtacagaagaaaagaacatcatcttaggcacttatcagatcctttccctcctt
ggtagaggtacctttggagaggtttataaagttagagtgctaaggggcagatacagaggc
aagatgatggctctgaaagtggcaagaaatgcggaagttttgccttacctttggagagaa
gttcagacgcttcttttgttcaaccaccctcacataatatccttgcagagctacctttac
aaaaaagatagaggagagctttatgtgctttacgagcttatggatgtgggtgaccttaag
gactatgtagtaagcaacggcaaactttcggaagagaacgctttaaaggtacttctgcat
gtggcaaaaggacttgagttcttgcacagcaggggatatatacacggggatgtaaagcct
gaaaacatctttggcaaaagggtgctcagggatgtggtctggaagctcggagactttgga
cttgtaaggataagaggtagcgaaagcatcatagatgtaaagggcactgcaggatacata
gcacctgaggtgttcaggggtgagatacacagaagcagtgatatattctctctgggttgt
gtccttcactttatgctgacaggaagggacccttttgagtgtgaagacagaaaagaaaaa
ctcaaaagaaacaaggaaggcgcatgcactatagaagatggtctgtctgagcgcataaaa
actcttctccatatcatgctgagcaaggatcctacaaaaaggttcaggacagcaaaggaa
cttattgagtacatgataagggagaggttagcatga

DBGET integrated database retrieval system