KEGG   Hydrogenobacter thermophilus: HTH_0812Help
Entry
HTH_0812          CDS       T01167                                 

Gene name
trxB2
Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hth  Hydrogenobacter thermophilus
Brite
KEGG Orthology (KO) [BR:hth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HTH_0812 (trxB2)
Enzymes [BR:hth01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HTH_0812 (trxB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like DAO FAD_oxidored NAD_binding_8 FAD_binding_3 Trp_halogenase Thi4 FAD_binding_2 TrkA_N NAD_binding_7 FMO-like
Motif
Other DBs
NCBI-ProteinID: BAI69272
UniProt: D3DHH0
LinkDB All DBs
Position
complement(749556..750485)
Genome map
AA seq 309 aa AA seqDB search
MHQLLIIGGGPAGISASIYASRKRMDFVLITEEVGGQVIKAGEIENYLGYAMVDGIAFVE
KIIQQMERLGVEPVLDRVIEVRKVSDGFVARTLSGKEYSAKTLLFCTGAEHRRLNVPGEK
EYTGRGVSYCYTCDAPFFRDVKVAVVGGGNSGFEAAQQLTHYASEIYLIEISDRFVADEV
LRENVLSHPKVKPLLRHRVLEIRGDKTGVREVLVEDLQSRSTYTLEVQGVFVEVGLKPNS
ELAKSLGVLTTSRDEIIIDCNNRTSERGIYAAGDCTNIFAKQIITAAGEGAKALLSIHHD
LTYGVSSWI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagcttttaataataggtggtggacccgcgggtatatccgccagcatatatgca
tcaaggaagagaatggattttgtcctcataacggaggaagtggggggtcaggtgataaag
gctggggagatagaaaactacctgggctacgctatggtggacggtatagcctttgttgag
aagataatacagcaaatggaaagactgggcgtagagcccgtgctggacagggtgatagaa
gtcaggaaagtcagtgatggctttgtagccagaactctttcaggaaaggagtactctgca
aaaaccctcctcttctgcacaggtgcggagcacagaaggctcaatgtaccgggggaaaag
gaatacacaggaagaggggtctcttactgctatacttgcgatgctcccttcttcagggat
gttaaggtggcggtggtgggagggggaaactcgggctttgaggctgcacagcagctgact
cactacgcttccgagatttacctcatagagatatcagacaggtttgttgcggacgaggtg
ctaagagaaaatgtgctaagccacccaaaagttaaacctctgctaaggcacagagtgctg
gagataaggggagataaaaccggtgtcagggaggtgcttgtggaagacctgcaaagcaga
agcacatacacacttgaagtgcagggcgtatttgtagaagtgggactaaagcctaactcg
gagctggctaaaagtctgggggttttgaccacaagcagggatgagattataatagactgc
aacaacagaacctcagagagaggtatttacgcagctggagactgcaccaacatatttgcc
aaacagataataacagctgccggggaaggagcaaaggctctgctatccatacatcatgac
ctcacctatggggtaagctcgtggatataa

DBGET integrated database retrieval system