KEGG   Halorhabdus tiamatea: HTIA_1568Help
Entry
HTIA_1568         CDS       T02781                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hti  Halorhabdus tiamatea
Pathway
hti00564  Glycerophospholipid metabolism
hti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hti00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HTIA_1568 (glpA)
Enzymes [BR:hti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HTIA_1568 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 FAD_binding_2 DAO_C NAD_binding_8 FAD_binding_3 3HCDH_N FAD_oxidored HI0933_like Pyr_redox_3 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: CCQ33695
UniProt: S6D2Z6
LinkDB All DBs
Position
1560695..1562461
Genome map
AA seq 588 aa AA seqDB search
MTATSPHVLVIGGGSTGVGIARDAAMRGFDVTLVEKGNLTHGTTGRMHGLLHSGGRYAVS
DQASARECIEENMILRDIATHCVEDTGGLFVKRPEDTEAYYQEKLAGLRECSIPATELTA
EEARRREPFLARDIDKAIEVPDAAIDPFRLCVANAISAQNHGARIETFSEVTDLLVEDGE
IVGAELTHESGEGKRVHGTEASVEEIRVDHIVNAAGAWTGEIAAMADIDVAVRPSKGVMT
IMNVRQVDTVINRCQPKGDADIVVPHETTAILGTTDEEVSDPADYPEEAWEVDLMIDELS
KLVPILEDARTIRSFWGVRPLYEPPETGTDDPTDITREFFLLDHDERDGVPGMTTIVGGK
LTTYRLMAEQLVDHLAEKFGMETTCRTAEEPLPGSEDAGVIDEAMDDFGLRSPVAKRSAE
RLGSRTQDVLDTDEPNPVVCGCEAVTRAEVKDAIEQSGTDLNAVRIRTRAGMGNCQGGFC
SHRLANELHPEFDEGRTRAALDELYEERWKGQRHALWGRQLSQAMITYAMHALTMNRDRD
PASDGGSLDFGAFDSGPASSPDTTDDGRPADGTADVATDGGRGDGRGD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctacatcaccacacgtgctcgttatcggcggtggctcgacgggtgtcgggatc
gcccgggacgccgcgatgcggggcttcgacgtgacactggtcgagaagggcaatctcacc
cacgggacgaccgggcggatgcacggcctgctccacagcggtggccggtacgccgtctcc
gatcaggcgagcgcgcgcgagtgcatcgaggagaacatgatcctccgggacatcgccacc
cactgcgtcgaggacacgggcgggctgttcgtcaagcgaccggaggacaccgaggcgtac
taccaggaaaagttggctgggctccgggaatgctcgattccggcaaccgaactcaccgcc
gaggaggcacgccggcgggagccgtttctcgcgagagacatcgacaaagccatcgaggtg
cccgacgcggcgatcgaccccttccggctgtgcgtggccaacgcaattagcgcacagaat
cacggcgctcgcatcgagacgttctcggaagtgaccgacctgctggtcgaggacggcgag
atcgtcggcgcggagctcacccacgagagcggcgagggaaagcgggtccacggcactgaa
gcgtccgtcgaagagatccgcgtcgaccacattgtcaacgcagccggggcctggacgggc
gagatcgcggcgatggcggacatcgacgtggcggtccgcccttcgaagggtgtgatgacc
atcatgaacgtccggcaagtcgacacggtgatcaatcggtgtcagcccaagggcgacgcc
gacatcgtcgtcccccacgagacgacggcgatcctcgggacgacagacgaggaggtgagc
gatcccgcggactacccggaggaagcgtgggaggtcgatctcatgatcgatgaactgtcg
aaactcgtcccgatcctcgaagacgcacgcacgatccgctcgttctggggcgttcgcccg
ctctatgagccccccgagaccgggaccgacgatccgacggacatcacgcgggagttcttc
ctgctcgatcacgacgagcgcgacggcgttcccgggatgacgaccatcgtcggcgggaaa
ctcacgacctatcggctgatggccgagcaactcgtcgatcacctcgccgagaaattcggg
atggagacgacctgccggacggccgaggagccactccccggcagcgaggacgcgggcgtc
atcgacgaggcgatggacgacttcggcctgcgctcgccggtcgccaaacggagcgccgag
cgtctgggctcgcgaacgcaggacgtcctcgacaccgacgaaccgaacccggtcgtctgt
gggtgtgaggcggtgacgcgcgcggaggtcaaagacgccatcgagcagtccggcactgac
ctcaacgcggtccggatccgcacgcgggccgggatgggcaactgccagggcggcttctgt
agccatcggctggcgaacgaactccaccccgaattcgacgaggggcgcacacgggcagcg
ctcgacgaactctacgaagagcgctggaagggtcaacgccacgcactctggggcagacag
ctctcccaggcgatgatcacctacgccatgcacgcgctgacgatgaaccgcgaccgcgat
cccgccagcgacggcgggtcgctcgacttcggcgcgttcgactccgggccggcgagcagc
cccgacacgaccgacgacggacgaccggcggacggaaccgcagacgtcgccaccgacggt
ggcaggggtgatggccgtggcgattga

DBGET integrated database retrieval system