KEGG   Halorhabdus tiamatea: HTIA_1598Help
Entry
HTIA_1598         CDS       T02781                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
hti  Halorhabdus tiamatea
Brite
Enzymes [BR:hti01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HTIA_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCQ33725
UniProt: F7PR29
LinkDB All DBs
Position
complement(1598788..1599909)
Genome map
AA seq 373 aa AA seqDB search
MGDDRDWATVLGVPDEDREDILGAFDASVFEGRRYRHLTDARHGIERGTAIVDGRVVRGF
PSIPRTLVLDPGIAEHFDGRLTVEEKRNGYNVRVARIDGDVLGFTRGGYICPYTTSKVRE
LLDPDSFFEAHPGLMLCGELIGPENPYTPHEYPEVESAAFEVFDIRDRESGRPLAVDRRR
EFCERHDLAMVPNFGEYDPAEATDAVREVIGDLDREGKEGVVLQSMDGTRQLKYTTSATH
RADLEHAFSLPFDYGRDFVFPRILREVFQAVELDRTNGESRQRAQELGEAILLPAIEAVR
AVERGETVGEDHTVRGDPDAIEALLSHLREMGITLEIQRDRRVGDERAVSFVKVSQATRD
NVENYLDGQLIDE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgatcgcgactgggcgaccgtgcttggcgtcccggacgaggaccgcgaggac
atcctcggggcctttgacgcgtccgtcttcgagggacgacgctaccgccacctcacggac
gcccgccacgggatcgagcgcgggacggcgatcgtcgatgggcgcgtcgtccgtggcttc
ccctcgatcccgcgaacgctggtactcgacccgggcatcgccgagcacttcgacgggcgg
ctcacggtcgaggagaagcgcaacggctacaacgtccgcgtcgcccggatcgacggcgac
gtcctcgggttcactcgcgggggctatatctgtccgtacaccaccagcaaggtgagagag
ctgctcgatcccgactcgttcttcgaagcgcatcccgggctgatgctctgtggcgagttg
atcggcccggagaacccatacacgccacacgagtatcccgaagtcgagtccgcggctttc
gaggtgttcgacatccgcgaccgggagagtggtcgaccactggcggttgatcgacggcgg
gagttctgtgagcgccacgacctggcgatggtccccaatttcggcgagtacgatccggcg
gaggcgaccgacgccgtccgcgaggtgatcggcgacctggaccgcgagggaaaagagggg
gtcgtgttgcagtcgatggacggtacccggcagctgaagtacaccacgtcggcgacgcat
cgagccgatctggaacacgcgttctcgctccccttcgactacggtcgagatttcgtcttc
ccgcggatcctcagggaggtgtttcaggccgtcgagctggatcgaacaaacggcgagtcc
cgccagcgcgcccaggaactcggggaggcgatcctcctgcccgcgatcgaagccgtccgg
gcggtcgaacgcggcgagaccgtcggcgaggaccacaccgtccggggtgaccccgatgcg
atcgaggcactgctctcgcacttgcgggaaatgggtatcacactcgaaatccagcgggac
cgccgggtgggtgacgaacgtgccgtctcgttcgtcaaagtctcgcaggcgacgcgggac
aacgtcgaaaactacctcgacggacagttgatcgacgagtga

DBGET integrated database retrieval system