KEGG   Halorhabdus tiamatea: HTIA_1662Help
Entry
HTIA_1662         CDS       T02781                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hti  Halorhabdus tiamatea
Pathway
hti00040  Pentose and glucuronate interconversions
hti00051  Fructose and mannose metabolism
hti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HTIA_1662
   00051 Fructose and mannose metabolism
    HTIA_1662
Enzymes [BR:hti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HTIA_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP NAD_binding_7 NAD_binding_3 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CCQ33789
UniProt: F7PNH2
LinkDB All DBs
Position
complement(1659172..1660206)
Genome map
AA seq 344 aa AA seqDB search
MQTAVLTEDLAFEFEDRERPTSDSDEVLVEMTDVGICKSDVHYWEHGKIGEYVVEDPLLL
GHESAGVIAEVGDDVEDLEVGDRVALEPGIVCGTCEHCRRGEYNLCPNVDFMATPPFDGA
FAEYVAWPADLAHPLPDNVSQVEGALCEPFAVGLHATRRGGVGHGDTVAILGGGTVGSVT
MEAAKAAGATDIIVGDIVDSKLERAEAHGADATVNVREGDFAATVEDYTDGRGADVVFEA
TDSEPDVEALIDAARRGGTVVMIGLADEATVEVDALEIITNELDVLGSFRDANRYGPAID
LLAEGAAEIEWIADFTEPLGNVQEAFERARDDDDAIKGMISIGE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagcagttctcaccgaggatctggccttcgagttcgaggatcgtgagcgaccg
acgtccgacagcgacgaggtactcgtcgagatgaccgacgtcggcatctgcaagtccgac
gtccactactgggagcacggcaagatcggcgagtacgtcgtcgaggacccactcctcctt
ggacacgagagcgccggcgtcatcgccgaggttggcgacgacgtcgaggatctcgaagtc
ggcgaccgagtcgcgctcgagccgggcatcgtctgtggcacctgcgaacactgtcgccgc
ggcgagtacaacctctgtcccaacgtcgacttcatggccacgccgccctttgacggcgcg
ttcgcggagtacgtcgcctggccggccgacctcgcacaccccctccccgacaacgtctcc
caggtcgagggcgcgctgtgtgaacccttcgcggtcggcctccacgcgacccgacgcggc
ggcgtcggccacggcgacaccgtcgcgatcctgggcggcgggaccgtcggctcggtcacg
atggaggccgccaaggcggcgggcgcgacggatatcatcgtcggcgacatcgtcgacagc
aaactcgaacgcgccgaagcacacggcgcggacgcgacggtcaacgtccgcgagggtgac
ttcgccgccactgtcgaggactataccgacggtcgcggggccgacgtagtcttcgaggcg
accgactcagaacccgacgtcgaggcgttgatcgacgcggcccgccgcggcgggacggtc
gtcatgatcggcctcgccgacgaggcgaccgtcgaggtcgacgccttagagatcatcacc
aacgaactcgacgtgcttggctcgttccgggatgccaaccgctacggcccggcgatcgac
ctgctggccgagggcgcggccgagatcgagtggatcgccgactttaccgaaccgctgggg
aacgtccaggaagccttcgagcgcgcccgcgatgacgatgacgcgatcaagggcatgatc
tcgatcggcgagtag

DBGET integrated database retrieval system