KEGG   Hydrogenophilus thermoluteolus: HPTL_0012Help
Entry
HPTL_0012         CDS       T05630                                 

Definition
(GenBank) phosphate transport system permease ATPase
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:htl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HPTL_0012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:htl02000]
    HPTL_0012
Enzymes [BR:htl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     HPTL_0012
Transporters [BR:htl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    HPTL_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_25 AAA_29 AAA_30 AAA_15 Rad17 AAA_16 AAA_24 TniB AAA_23 ABC_ATPase AAA_5 G-alpha AAA_33 NACHT NB-ARC Zeta_toxin AAA_28
Motif
Other DBs
NCBI-ProteinID: BBD76282
UniProt: A0A2Z6DV24
LinkDB All DBs
Position
11338..12150
Genome map
AA seq 270 aa AA seqDB search
MDQPQRIVHEATGVTLDAPVKAQAKGFHFYYGAHHALKDLNMPVAEKRVTALIGPSGCGK
STFLRSFNRMHDLYPGNRYVGEIRLYPDDINLVSPEVDPIEIRMRVAMVFQKPNPFPKSI
FDNVAYGLTVRGMKNRTEIADRVEAALKAAALWDEVKDRLDALGTSLSGGQQQRLCIARA
LAAEPEILLLDEPTSALDPIATASIEELVTELRDRVTILIVTHNMQQAARISDYTAFMYL
GELVEFGPTDEIFVRPKKKQTEDYLTGRFG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaccacaacgcatcgttcatgaagccaccggggtaacactcgacgcgccggtg
aaagcgcaagccaaagggttccacttctactacggcgcgcaccatgcgctcaaagacctc
aacatgcccgttgcggaaaaacgggtgacggcgctgatcggcccttcggggtgcgggaaa
tcgactttcctgcgcagcttcaaccgcatgcacgacctctacccgggcaaccgctatgtt
ggtgaaatccgtctctatccggacgacatcaacctggtttcgcccgaagtcgacccgatc
gagatccgcatgcgggtggcgatggtgtttcagaagcccaacccgtttccgaaatcgatc
ttcgacaacgtcgcgtatggtttgacggtccgtggcatgaaaaaccgcaccgaaatcgcg
gaccgggtggaagcggcgctcaaagcggcggcgttgtgggacgaagtgaaagaccggttg
gatgcgttgggcacgtcgctttccggcggacagcagcagcggctctgcatcgcgcgggcg
cttgcggcggaaccggagattttgctgctcgacgagcccacgtcggcgctcgatccgatt
gcgaccgcgtcgatcgaagagctggtgaccgaactgcgcgaccgggtgacgattctgatc
gtgacccacaacatgcaacaagcggcacggatctccgattacaccgcgttcatgtatttg
ggggaactggtcgagttcggcccgacggacgagatcttcgtccgcccgaaaaagaaacag
accgaagactacctcaccggccgtttcggttga

DBGET integrated database retrieval system