KEGG   Hydrogenophilus thermoluteolus: HPTL_0046Help
Entry
HPTL_0046         CDS       T05630                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HPTL_0046
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:htl02000]
    HPTL_0046
Enzymes [BR:htl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HPTL_0046
Transporters [BR:htl02000]
 Other Transporters
  Pores ion channels [TC:1]
   HPTL_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6 2Fe-2S_Ferredox Dehyd-heme_bind
Motif
Other DBs
NCBI-ProteinID: BBD76316
UniProt: A0A2Z6DV50
LinkDB All DBs
Position
complement(49288..49911)
Genome map
AA seq 207 aa AA seqDB search
MNDMLTLYYSPGACSLSPHIALREAELPFVLVRVDLAKKQTETGEDFRKVNPTGYVPCLQ
FADGRTLTEGPAIVQYIADQAPEKGLAPANGTWERYLLQQWLNFISTEIHKSYSPLFKPN
TSQDHKNFARDLLTTRLEYVAHELANRPYLLGERFSVADIYLFVTLSWAQYVAIDLTQWP
TLTQFLTRVGSRPAVQAALRTEGLVKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatgctcaccctctattattcaccaggcgcctgttcgctttcaccgcacatc
gcgttacgcgaagcggaattgccgtttgttttggtccgcgtcgatctggccaaaaaacag
acagaaaccggcgaggatttccgtaaggtgaaccccaccggttatgttccctgcctgcag
ttcgccgatggccggactttgaccgaggggccagccatcgtgcaatacatcgccgaccag
gccccggaaaaaggtttggctcccgcgaacggcacctgggaacgctacctgttacaacag
tggctcaatttcatctcgaccgaaatccataaaagctacagtcctctgttcaaaccgaac
acatcacaagaccacaaaaattttgcccgcgatctccttacgacgcggttggaatatgtg
gcccatgagctagcgaaccgcccctaccttttgggcgaacgcttctcggttgcggatatc
tacctctttgtgacgttgagttgggcacagtatgtcgcgatcgatctcacgcagtggccg
accctcacccaatttctaacgcgcgtaggaagccgccctgcagtccaagccgcgttgcgg
accgaagggctcgtcaaatcgtga

DBGET integrated database retrieval system