KEGG   Hydrogenophilus thermoluteolus: HPTL_0183Help
Entry
HPTL_0183         CDS       T05630                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
htl  Hydrogenophilus thermoluteolus
Brite
KEGG Orthology (KO) [BR:htl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPTL_0183 (ahpF)
Enzymes [BR:htl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HPTL_0183 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO FAD_oxidored HI0933_like Thi4 FAD_binding_3 NAD_binding_8 NAD_binding_9 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: BBD76453
UniProt: A0A2Z6DVL8
LinkDB All DBs
Position
203823..205400
Genome map
AA seq 525 aa AA seqDB search
MALLDEQTQAALRQYLERLVEPIELVTALDASDAAKQLGELIEAIRAASPKVTVREAMGD
EVAGGRRPAFAVTRPGEAPRVHFAGLPLGHEFASLILALLQVSGYPPKVDQAVIDQVKSL
TAPLAFEVYVSLSCHNCPDVVQAVNAIAALNPNVTAVMIDGARFPQEVESRQIMAVPTVY
LNGALFGQGRMELPEILAKVDTKNDERVRAQLAQKPLFDVLIVGGGPAGAAAAIYAARKG
ITTGIVAERFGGQVMDTLAIENFISVKETEGPKLVAGLEEHVKAYEVDVMNHQRAVGLRP
GAAGQPAVVQLANGAELKAKTVILATGARWRELNVPGEREYRGKGVAYCPHCDGPLFKGK
PVIVVGGGNSGVEAAIDLAGIVHHVTLLEYADALKADAVLQKKLASLPNVTVITQAETLE
ILGDGQKMTGLRYRDRASGEERQIDAAAVFVQIGLVPNTDWLDGVVARNRFGEIEIDPRC
ATSVPGIFAAGDCTTVPYKQIIIAMGEGAKAALSAFDFLIRQSAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcacttttagatgaacaaacccaagcggcacttcggcaatatttggaacggttggtc
gaaccgatcgagctcgtgaccgcgctcgacgccagcgacgcggcgaagcaattgggcgag
ttgatcgaagcgattcgcgcagccagtcccaaggtgacggtgcgcgaagcgatgggagac
gaagtcgcgggcgggcggcgccctgcgtttgcagtgacccgtcccggcgaggcaccgcgg
gtccattttgccgggttgccgttggggcacgagttcgcttcgctcattttggcgctgctg
caggtgagcggctacccccccaaggtggatcaggcggtgatcgaccaggtcaaaagcctt
actgcgccattggcgttcgaggtctatgtctcgctttcctgccacaactgcccggatgtg
gtgcaggcggtgaacgcgattgcggcgctcaaccccaacgtcaccgcggtgatgatcgac
ggtgcgcgttttccgcaggaggtcgagtcccggcaaatcatggcggtgcccaccgtctac
ctcaacggtgcgctcttcggccaagggcggatggagctgccggagatcctggccaaggtc
gacaccaaaaacgacgaacgggtgcgtgcgcaattggcgcaaaagccgcttttcgacgtc
ttgatcgtcggcggcgggccagccggtgcggcggcggcgatctatgccgcgcgcaaaggg
atcacgacgggcatcgtcgccgaacgctttggcggtcaggtgatggatacccttgcgatc
gagaacttcatttcggtcaaggagaccgaagggccgaaattggtcgctggactcgaagaa
cacgtcaaggcgtatgaggtcgatgtgatgaaccatcagcgcgccgtggggttgcgtccc
ggcgcggcggggcagccggcggtggtccagctcgccaacggcgccgagctcaaggcgaaa
acggtgatcttggcaacgggggcgcgctggcgggagctcaacgtgccgggggaacgggaa
taccgcggtaaaggggttgcgtactgcccccactgcgatgggccactcttcaaaggtaag
ccggtgatcgtcgtgggcggcggcaattccggcgtcgaggcggcgatcgaccttgcggga
atcgtccaccatgtgacgctcctcgagtatgccgatgcgctcaaggccgacgcggttttg
cagaaaaaactcgcttcgctgccgaacgtcaccgtgatcacccaagcggaaacgctcgag
atcttgggagacgggcagaagatgaccgggttgcgctatcgcgaccgcgcttcgggggaa
gagcggcagatcgacgcggcagcggtcttcgtccaaatcgggttggtgcccaacaccgat
tggctcgacggggtagtggcgcgcaaccgtttcggcgagatcgagatcgatccgcggtgc
gcgaccagtgttccgggaatttttgccgcgggcgattgcaccacggtgccctacaaacag
attatcattgcgatgggcgaaggagcaaaagcggcgctttcggcgttcgactttctgatc
cgccaaagcgccgcgtag

DBGET integrated database retrieval system