KEGG   Hydrogenophilus thermoluteolus: HPTL_1026Help
Entry
HPTL_1026         CDS       T05630                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:htl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    HPTL_1026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:htl03400]
    HPTL_1026
Enzymes [BR:htl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     HPTL_1026
DNA repair and recombination proteins [BR:htl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HPTL_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF3391
Motif
Other DBs
NCBI-ProteinID: BBD77290
UniProt: A0A2Z6DXX3
LinkDB All DBs
Position
1083834..1084667
Genome map
AA seq 277 aa AA seqDB search
MTDPLRRFAWLDAMELTPLWRLRSRWLISDRSAQTQTDTQTNPQDVTIDTDRSAPRYPCQ
QTQRQASRQPTPPQAPPEPPSSRFPERAEQIATMDWEALEAAIRRCQACPLSRERTQAVP
GVGDHRARWLFVGEGPGREEDRQGEPFVGPAGKLLDEMLFALGLRRGADVYIANAVKCRP
PLNRTPHPEEIAACNPFLARQIALLAPRIIVALGKPAAFALLDEEVKIAQARGRRFDYHG
IPVVVTYHPAYLLRNPADKRKAWEDLLFARRILMQQV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgttgcgccgtttcgcatggctcgacgcgatggaactcacgccgctttgg
cggttgcggtcccgttggcttatctccgatcgttctgcgcagacgcagaccgatacccaa
accaacccccaggacgtcacgatcgataccgaccgttcggcgccgcgctacccgtgccag
cagacacaacggcaggcgtcccgccaaccaaccccaccccaagcgccgccagagccccct
tcgtcgcgattccctgagcgggccgagcagatcgccacgatggattgggaggcgctcgaa
gcggcgattcgccgctgtcaagcctgtccgttgtcgcgtgagcgaacccaagcggtgccg
ggtgtaggggatcaccgtgcccgctggctctttgtcggcgaagggccgggacgcgaagag
gatcgccagggagagccgttcgtcggaccggcagggaagttgctcgatgagatgctcttt
gcccttgggctcagacgcggtgcggatgtctatatcgccaacgcggtgaaatgccgcccc
cctttgaaccgaacgccgcacccggaagagatcgccgcctgcaacccgttcctcgcgcgt
caaatcgcactccttgcgccccgcatcatcgtcgcgttgggcaagccagctgcttttgcg
ctcctcgacgaagaggtgaaaatcgcccaagcgcgtggtcgtcgcttcgattaccacggg
attcccgttgtcgtcacctaccatcccgcctatttgttgcgcaacccggcagacaaacga
aaggcgtgggaagacttgctctttgcgcgccgaattttgatgcagcaggtataa

DBGET integrated database retrieval system