KEGG   Hydrogenophilus thermoluteolus: HPTL_1159Help
Entry
HPTL_1159         CDS       T05630                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00061  Fatty acid biosynthesis
htl00780  Biotin metabolism
htl01100  Metabolic pathways
htl01130  Biosynthesis of antibiotics
htl01212  Fatty acid metabolism
Module
htl_M00083  Fatty acid biosynthesis, elongation
htl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPTL_1159 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPTL_1159 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HPTL_1159 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:htl01004]
    HPTL_1159 (fabI)
Enzymes [BR:htl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HPTL_1159 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HPTL_1159 (fabI)
Lipid biosynthesis proteins [BR:htl01004]
 Fatty acid synthase
  Component type
   HPTL_1159 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: BBD77423
UniProt: A0A2Z6DY67
LinkDB All DBs
Position
1233285..1234082
Genome map
AA seq 265 aa AA seqDB search
MGFLAGKKILITGLLSNRSIAYGIAQACAREGARLAFTYQNERFEGRIAKFATEFGADFI
APLDVTRDEEITGLADRIAQEWEGLDGFVHSIAYAPNEALEGDFLDGFTREAFRIAHEVS
AASFPLMAKAFRPLMQNRKSSMLTLSYLGAVRTMPNYNLMGMAKASLEAGVRYLAASLGP
EGIRVNGVSAGPIKTVAASGIGSFSRLLRYNEHHAPLRRNVTIEEVGNASAFLLSDLASG
ITGEILYVDGGFHNVALGNPEPLVL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttggcgggtaaaaagatcctgatcaccgggctactcagcaaccgctcgatc
gcttatggcatcgcgcaagcgtgcgcgcgggaaggcgcacgtttggcgttcacctaccaa
aacgaacggttcgaagggcgcatcgccaagttcgcaacggaattcggggccgatttcatc
gcgccgctcgacgtgacgcgcgacgaagagatcaccgggcttgccgatcgcatcgctcaa
gaatgggaagggttagacggtttcgtccattccattgcctatgccccgaacgaagcgctc
gagggcgattttctcgacgggttcacgcgcgaagcgtttcgcatcgcccatgaagtgagc
gcagcgagttttcccctgatggcgaaagcgtttcggccgttgatgcaaaaccgaaagtcg
tcgatgttgacgctctcgtatcttggcgctgtgcgcacgatgcccaattacaacctgatg
ggaatggccaaggccagtctggaagcgggtgtgcgctacctggcggcaagcttgggacct
gaggggatccgcgtaaacggtgtctcggcaggcccgatcaaaaccgttgccgcgtcgggc
attggcagtttcagcagactccttcgctacaacgaacaccatgcgccgctgcgccgcaac
gtcacgatcgaagaggtgggcaacgcctcggcgttcctcctttcggatctcgcaagcggc
atcaccggcgagattctctacgttgatggcggttttcacaacgtcgcgctcggcaacccc
gaaccgctcgtcttgtaa

DBGET integrated database retrieval system