KEGG   Hydrogenophilus thermoluteolus: HPTL_1471Help
Entry
HPTL_1471         CDS       T05630                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00030  Pentose phosphate pathway
htl01100  Metabolic pathways
htl01120  Microbial metabolism in diverse environments
htl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HPTL_1471
Enzymes [BR:htl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HPTL_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BBD77733
UniProt: A0A2Z6DZ30
LinkDB All DBs
Position
complement(1564704..1566554)
Genome map
AA seq 616 aa AA seqDB search
MGYANRILRVNLTTGACQAEPLNEKWAQLYLGSRGLASRYLVAEVDPKVDPLSPENKLIF
ATGPLTGTIASTGGRYTVVTKGPLTGAIACSNSGGFFGAELKFAGWDMIIFEGRAEKPVY
LYVEDDQAELRDASELWGKSVWETEEWIKAKHQDPLIRVSSIGRAGENQILFSCIVNDLH
RAAGRSGVGAVMGSKHLKAVAVRGTKGVKVKDLKRFLAATNAAKQVLATNPVTSQGLPKY
GTQVLMNVINEVGALPTRNMREVQFEGADAISGEAMHRPRPSDGKPQLVTNAACFGCTIA
CGRISKIDKNHFTVKNSPKYWGASGGLEYEAAWALGADTGVDDLEALQYANLLCNEQGMD
PISFGSTVAAVMELYERGVLTAEQIGFPAPFGSAEALAKLAELTAKGEGFGRDVGLGSKR
LCEKYGHPELSMTVKGQEFPAYDPRGIQGMGLAYATSNRGACHLRGYTVASEILGIPEKT
DPLTTEGKPELVKAFQDATGAFDSAGICVFTSFAWTVADIAPQLDAAIPGEWTPERLLEV
GERVWNLERWFNTRAGFSAKDDTLPKRLLEEPAATGPAKGMVNRLGEMLPKYYEVRGWTA
DGVPKPETLARLGVDV
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgcaaaccgcattttgcgcgtcaatctgacgacgggggcctgccaagccgaa
ccgctcaacgaaaagtgggcgcagttgtacctggggtcgcgggggttggcaagccggtat
ctggttgcagaggtcgatccgaaggtggatccgctctcgcccgaaaacaaattgatcttt
gctaccgggcccctcacggggacgattgcctcgaccggtgggcgctacacggtggtgacg
aaagggccactcaccggtgcgatcgcgtgttccaactccgggggatttttcggcgctgag
ctgaaatttgccggttgggacatgatcattttcgaagggcgtgccgaaaaaccggtctat
ctctacgtggaagacgaccaggccgaactgcgagacgcctccgaactgtggggcaaaagc
gtctgggagaccgaggagtggatcaaggcgaagcaccaagatccgctgattcgcgtctcg
tcgattggccgtgcgggggagaatcagatactcttttcgtgcatcgtcaatgacttgcac
cgcgcagccgggcgttccggcgttggggcggtgatgggttcgaagcacctcaaagcggtg
gcggtgcgggggaccaaaggggtcaaggtcaaagatctcaaacggttcttggcggcaacg
aacgccgcaaagcaagtgctggcgaccaacccggtgaccagccaagggttgccgaaatat
ggcacccaggtgttgatgaacgtgatcaacgaagtgggggcgttgcctacgcgcaacatg
cgcgaagtacagttcgaaggggccgatgcgatctcaggcgaagcgatgcaccgcccgcgg
cccagcgacggtaaaccgcaattggtgaccaacgcagcttgtttcgggtgcacgattgcg
tgtggtcggatttcgaagatcgacaaaaaccacttcacggtgaaaaacagcccgaaatat
tggggggcgtccggaggtttggaatacgaagcagcctgggcattgggggccgataccggg
gtcgacgacctcgaagcgttgcagtatgcgaacctcttgtgcaacgaacaagggatggac
ccgatctcgttcggttcgaccgtagccgcggtgatggagctctatgagcgcggggtactc
actgcggaacagatcggctttccggcgccgttcggttcggcggaagcgcttgcgaaactg
gctgaactgactgcgaagggcgaagggttcggtcgcgacgtcgggttaggttcgaagcgg
ctctgtgagaagtatggccatccggaactctcgatgacggtcaaagggcaggagtttccg
gcgtacgacccgcggggaatccaagggatggggctcgcgtacgcgaccagcaaccgcggc
gcgtgccatctgcgcggctataccgtggcgtcggaaatcctgggtataccggagaagacg
gacccactcaccacggaaggaaaaccggagttggtaaaggcgttccaggatgccaccggt
gcgttcgattccgctgggatctgcgtgtttaccagtttcgcctggacggttgccgacatc
gcgccgcagctcgacgcggcgattccgggagaatggacaccagaacggctgcttgaagtg
ggcgagcgggtctggaacctggagcggtggttcaacacgcgagctggcttttccgcaaag
gacgacacgctgccgaaacggctgctcgaagagccagcagcgacgggtcccgcgaaaggg
atggtaaaccgcttgggcgaaatgctcccgaaatactacgaagtgcgcggctggaccgca
gacggtgtgccgaagccggaaacgttggcccgtttgggtgtcgacgtgtga

DBGET integrated database retrieval system