KEGG   Hydrogenovibrio thermophilus: EPV75_03575Help
Entry
EPV75_03575       CDS       T05808                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
htr  Hydrogenovibrio thermophilus
Pathway
htr00473  D-Alanine metabolism
htr00550  Peptidoglycan biosynthesis
htr01100  Metabolic pathways
htr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:htr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EPV75_03575
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EPV75_03575
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EPV75_03575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:htr01011]
    EPV75_03575
Enzymes [BR:htr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EPV75_03575
Peptidoglycan biosynthesis and degradation proteins [BR:htr01011]
 Precursor biosynthesis
  Amino acid ligase
   EPV75_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 TTL ATP-grasp RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: QAB14815
UniProt: A0A410H1N8
LinkDB All DBs
Position
779771..780709
Genome map
AA seq 312 aa AA seqDB search
MQEPWNRTDLNDALGRVAVLMGGTAAERDISLKSGTEVAKALQQTGVNATACDVKSVQDV
LAVTEQYDRAFIALHGRWGEDGGVQALLDALDFPYTGSQMTASALAMDKLRTKWLWQGVG
LPTPGFQVVSPSRPFDKGGFDLRFPVIVKPSHEGSSIGMRKVDDLDSLEDAIAFAQDYDT
EILIEQWVTGREYTCAVLGDSALPMIHLKTDHDFYDFDAKYQSSTTQYICPCGLPSEQEA
SIQALVVEAFHAIGARHWGRVDLMLDENDQAWLIELNSVPGMTDHSLVPMAAKAAGIDFP
ELVRRILSMTLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaccttggaacagaaccgatttgaatgatgcgctggggcgggttgcggtcttg
atgggcggcaccgccgctgaacgtgacatttcgttgaagagcgggaccgaggttgccaag
gccttgcagcaaaccggtgtgaatgcgacggcgtgtgatgtgaaaagtgttcaggacgtg
ctggcggtgaccgagcagtatgaccgggcttttatcgcgttgcacggtcgttggggtgag
gacggtggtgttcaagccctgctggatgcgttggattttccgtacaccggcagtcaaatg
acggcgtcagccttggcgatggataagttgcgcaccaaatggttatggcagggtgtaggc
ttgccgacgcccggttttcaggtggtatcgccgtcccggccgtttgataaaggcgggttc
gatttgcgctttccggtcattgtgaaaccgagtcacgaaggttccagtatcggcatgcga
aaagtcgacgatttggattctctggaagacgccattgcatttgcgcaggattacgatacg
gaaattttgatcgagcaatgggtgaccgggcgggaatatacctgtgcggttctgggcgat
tcggccttgccgatgattcatttgaaaaccgatcacgatttttacgattttgatgccaaa
taccaatccagcaccacgcagtatatctgtccctgcgggttgccgtcggaacaggaagcc
agcattcaagccttggtggtggaagcgtttcatgccatcggtgcgcgtcattgggggcga
gtggacttgatgttggacgaaaacgaccaggcctggttgattgagttgaacagcgtgccg
gggatgaccgaccacagtctggtgccgatggcggcaaaggcggcgggcatcgattttccg
gagctggtgcgtcgaatcctgtcgatgaccttggcgtaa

DBGET integrated database retrieval system