KEGG   Hydrogenovibrio thermophilus: EPV75_06630Help
Entry
EPV75_06630       CDS       T05808                                 

Definition
(GenBank) glycosyltransferase
Organism
htr  Hydrogenovibrio thermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_hydro_17 Cellulose_synt Glyco_tranf_2_2
Motif
Other DBs
NCBI-ProteinID: QAB15362
UniProt: A0A410H362
LinkDB All DBs
Position
complement(1419471..1422074)
Genome map
AA seq 867 aa AA seqDB search
MQNLLILLSFALFTFGSYAYFNKPLEEPSWPTTIPGFAFSPYHYDQSPFSGIYPTTESIE
KDLEILSGMVHAIRTYSATGVFGEIPELAAKHNINLALGAWIDGDFETNEQELKALEEIV
HRPPYNVVRAIVGNEAVLRKEISVDQMSAYLERMQKALDVPVSTAEPWHVWMKYPELAEH
ADYLAVHMLPFWEGVPVESAVDYIVDKMALLSENFPNKPIVIAEVGWPSNGRSIKEASAS
NANEAIFLRRFLDKARTEGYVYYVMEAFDQPWKADLEGAVGAYWGVYDVNRQPKFEFYKP
IIPIKEWRILAIASILLAVFLVLFLLMDSRNLKKRGRTFLVAIAFFASSVIIWVVYQHTL
LYQDWISRMVGLLLMLGVMGVWLVILVEAHEWAEALWLRKHRRLLLPSSLPETTSTSRDW
PFISVHVPAYNEPPDMMIETLDALSRLDYPSFEVLVIDNNTQNENVWRPVQQHCKKLGTR
FRFFHVSPLEGFKAGALNFALKHTHTEAEAIAVIDSDYQVESDWLKRLVVHFDEPEVAIV
QAPQDYRDFNENAFKAMCYAEYKGFFHIGMVTRNERNAIIQHGTMTLVRRKVLQEVGGWG
ETTITEDAELGLKIFEHGYQATYESTSYGRGVMPDTFMDYKKQRYRWAYGAMQIMREHAG
ALFLNQTHLNLGQRYHFIAGWLPWIADGFNFIFTLLAIIWSLLMISNPIHFNAPNIMISL
VPILFFGFKLLKMLALYLTRMHASFVTATGAAVAGLALSHTIAKAVLSGLFIGRKVPFLR
TPKGRQSAAILQALKDAGQETALVTILASLVLVIYWRVGFESLETLFWCIVLGVQMMPYL
AAVILSTISAFPSVSARWLRFNSVTTG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacttactcatcttattatcattcgctcttttcacatttggttcttacgcttat
tttaataaaccacttgaagaaccatcctggccaaccacaattcccggttttgcattttcc
ccatatcattacgatcaaagccctttctccgggatttacccaaccacagaatcaatcgaa
aaagacctggagatcttatccggaatggttcacgctattcgcacatattccgcgacaggc
gtatttggtgagattcccgagctcgcggcaaaacacaacattaacctcgcgctcggcgcc
tggattgatggtgacttcgaaacaaatgaacaagaactgaaagctctggaagagattgtt
catcgtccgccatacaatgttgtgcgcgccattgtcggaaatgaggcagtactgagaaaa
gaaatcagcgttgatcaaatgtccgcttaccttgaaagaatgcaaaaggcgctggatgtt
cctgtgagtacagccgagccatggcatgtttggatgaaatacccggagttggccgagcat
gcagattatctcgccgtccatatgctgcccttctgggaaggtgttccggtagaaagtgcg
gttgattatattgtcgataaaatggctttgctgagcgaaaactttcccaacaaaccgatt
gtcattgccgaggtaggctggcccagtaatggacgcagcatcaaagaagcttctgcttca
aatgccaacgaagccatttttttaagacgtttcctcgataaagctcgaacggaaggttac
gtttactacgtcatggaagcttttgatcaaccttggaaagccgatctggaaggtgctgtc
ggggcttactggggtgtttatgatgtaaaccgtcaacccaaattcgaattttataaaccc
atcattccgattaaagaatggcgaattcttgccattgcatccattttattagcggtattt
ttagtacttttcttactgatggatagccgtaatttgaaaaaacgcggacggaccttcttg
gttgccattgcgttcttcgcttcctccgttattatttgggttgtttatcagcacaccctg
ctttatcaagactggatcagccgaatggttggcctcttactgatgcttggggtcatgggg
gtttggctggttatattggttgaagcgcacgaatgggccgaagccctctggttacggaaa
catcgccggcttttactaccctcttcccttccagagacgacttcaacctctcgagattgg
ccgtttatttccgttcacgtaccggcttataatgaaccaccggacatgatgatcgagacc
ctcgatgcgctttctcgcctggattatccgagtttcgaagtactggtcattgataataac
actcaaaatgaaaatgtctggcgaccggttcagcagcattgcaaaaaattgggcacacga
tttcgtttttttcatgtttcgccgctggaagggttcaaagccggggccctgaattttgca
ttaaaacatacgcatacggaggccgaagccattgctgtgatcgacagtgattatcaggtt
gaatcggattggttaaaacgcttggtcgtgcattttgacgaaccggaagtggcaattgtt
caagccccgcaagactatcgtgatttcaatgaaaatgcctttaaggccatgtgctatgcc
gaatataaaggctttttccatatcggcatggtgacccgcaacgaacggaatgccatcatc
cagcatggcaccatgacattggttcgacgaaaagttctgcaagaagtcggtggttggggt
gaaacgaccattaccgaagacgctgaactcggtcttaaaattttcgaacacggctatcaa
gccacttatgaatccaccagctatggccgcggcgtcatgccggatacgtttatggattac
aaaaaacaacgttatcgctgggcctatggtgccatgcagattatgcgggaacatgccggc
gcccttttcctcaaccaaacacacttaaacctcgggcaacgttaccacttcatcgccggc
tggttgccttggattgccgatggtttcaattttattttcacgctattggccatcatctgg
tcattattaatgatcagcaacccgattcactttaatgcgccgaatattatgatttcactg
gtgccgattttattctttggtttcaaactattgaagatgctggccctttatctgactcga
atgcatgccagttttgttacggccactggcgcggccgtggccgggctggcattgtcacac
accattgcaaaagccgtgttgtctggtttgtttatcggtcgaaaagtgccctttttacga
accccaaaagggcgccagtcggcggcgattttgcaagcattgaaagacgccggccaagaa
accgcactggtcacgattttagcatcattagtgctggtcatttactggcgagtgggcttc
gaatcacttgaaacattgttttggtgcatcgtgctgggtgtgcaaatgatgccttatttg
gcagccgtaatcttatcgaccatcagtgcgtttccatccgtttccgctcgatggctgcga
ttcaattcagtgacaaccggctaa

DBGET integrated database retrieval system