KEGG   Haloterrigena turkmenica: Htur_2494Help
Entry
Htur_2494         CDS       T01154                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00620  Pyruvate metabolism
htu00680  Methane metabolism
htu00720  Carbon fixation pathways in prokaryotes
htu01100  Metabolic pathways
htu01120  Microbial metabolism in diverse environments
htu01200  Carbon metabolism
Module
htu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Htur_2494
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_2494
   00680 Methane metabolism
    Htur_2494
Enzymes [BR:htu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Htur_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 KfrA_N
Motif
Other DBs
NCBI-ProteinID: ADB61371
UniProt: D2RVU2
LinkDB All DBs
Position
complement(2557231..2559924)
Genome map
AA seq 897 aa AA seqDB search
MRLHNREIRQDVRELGALLGDVLEDQTSRQGFETVESCRRAAIDYRSGDLESREPLISRL
EGLSPHNQRIVARAFTTYFELINLAEERERVRTIRTESNEGTLEDSLEMAAEELGERGVD
TVEDVLDDVLIEPTFTAHPTEARRKTVKSKLRTISTHLETLDERLLTEKEQSQVWRDIDA
EVTSLWQTPQVRNRQPEPEDEARNVQWYLENTLFDVVGEVYDELADAIDAETAGDLEIPK
LFEFRSWAGSDRDGNPYVTPEVTANVLERQREVVLEKYRDELKRLSGVLSQDGSRIDTGG
EFEASLEDDRERLPGSARTAEDRYPGEPYRQKLKLMRERLARVGDVRPGGYDDVDELLDD
LAVIAQSLRNNSGESVVEAHVDPIRRQVATFGFSLASLDLREHQQKHTGAIAEALEREGI
DYRSLSEDERVELLTDAVLQDDPLVDLSETSDLSEDSARVLELFDSLGDWQTEYGVEAID
TYAISMTDEPSHVLEVLFLADQAGVVSLPEHAGIDIVPLLETEYALSGARRIMGTLFENE
AYSQALEARGRTQEIMLGYSDSNKENGFLAANWSLFKNQRRLGEICDDYDVQMRLFHGRG
GSISRGGGPMNEALLALPNNTITGQVKFTEQGEAIAEKYANPRIAERNIEQMLNAQLRAR
LYAKEEPDEEELPEEWFDAMETMADAARQEYRDLLESDGFVQYFEQATPISVIEDLDLGS
RPASRSGERTVEDLRAIPWVFSWTQSRCILPGWYAVAAGIDAYLEDGGSMETMQEMYDQW
PFFRTTLDNAALSLSRTELEIADQYADLADSELRERFFPRITDEYQRATELITEIGQRED
LHTRDWLGENLARRNPYVDPLNVLQVYLLDRNHRTDVEERTLRLTVKGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcacaacagggagattcgacaggacgttcgagaactcggcgcgttactcggg
gacgttctcgaggaccagacctcccggcaggggttcgagacggtcgagtcgtgccggcgg
gcggcgatcgattaccgatcgggcgacctcgagtcccgtgagccgctgatctcgcgactc
gaggggctctcgccccacaatcagcggatcgtcgcgcgggcgtttacgacctacttcgaa
ctgatcaacctcgcggaggagcgcgagcgagtccgaacgatccgcaccgaatccaacgag
ggaacgctcgaggacagcctcgagatggcggccgaggaactcggcgagcgcggcgtcgac
accgtcgaggatgtgctcgacgacgttctcatcgagccgacgttcacggcccatccgacg
gaggcgcggcgcaaaacggtcaaatcgaagctgcggacgatctcgacgcacctcgagacg
ctggacgaacggctgctgaccgagaaggagcagtcgcaggtctggcgggacatcgatgcc
gaggtgacgagcctctggcagaccccacaggtgcgaaaccgccagcccgagcccgaagac
gaggcgcgcaacgtccagtggtacctcgagaacaccctgttcgacgtcgtcggcgaggtc
tacgacgagctcgccgacgcgatcgacgcggagacggcgggcgacctcgagattccgaag
ctgttcgagttccgctcgtgggcgggcagcgaccgcgacggcaacccctacgtgacgccc
gaagtgaccgcgaacgtcttggagcgccagcgcgaggtcgtcctcgagaagtaccgtgac
gagctcaagcgcctctcgggcgtcctgagccaggacgggagccggatcgacaccggcggc
gagttcgaggcctccctcgaggacgaccgcgagcgactgcccggaagcgctcgcaccgcc
gaagatcggtacccgggtgagccctaccgccagaaactcaaactcatgcgcgagcgcctc
gcgcgcgtcggcgacgtccggccgggtggctacgacgacgtcgacgaactcctcgacgat
ctcgcggtcatcgcacagagtctgcggaacaacagcggggagagcgtcgtcgaggcccac
gtcgatccgatccgcagacaggtcgccaccttcggcttctcgctggccagtctggacctg
cgcgaacaccagcagaaacacaccggcgctatcgccgaggccctcgagcgagaggggatc
gactacagatcgctctccgaggacgaacgcgtcgaactgctgaccgacgcggtcctacag
gacgaccccctcgtcgatctctcggagacgagcgacctctccgaggactcggcgcgagtc
ctcgaactcttcgacagcctcggggactggcagaccgagtacggcgtcgaagccatcgac
acctacgccatctcgatgaccgacgagcccagccacgtcctcgaggtgctgttcttggcc
gatcaagccggcgtcgtctcgctgcccgaacacgcggggatcgacatcgttccgctgctc
gagaccgagtacgccctctcgggagcgcgacgcatcatggggacgctgttcgaaaacgag
gcctacagtcaggccctcgaggcccgcgggcggactcaggagatcatgctgggctactcg
gactcgaacaaggagaacggcttcctggcggccaactggtcgctatttaaaaaccagcgc
cggctgggcgagatctgcgacgattacgacgtccagatgcggctgttccacggccggggt
ggctcgatttcccgtggcggcgggccgatgaacgaggcgctgctggccctgccgaacaac
acgatcaccggccaggtcaagttcaccgaacagggcgaggccatcgccgagaagtatgcc
aacccccgtatcgccgagcgcaacatcgagcagatgctcaacgcccagctccgggcgcgg
ctgtacgcgaaggaagaacccgacgaggaggagctccccgaggagtggttcgacgcgatg
gagaccatggccgacgccgcccggcaagagtaccgggatctcctcgagagcgacggcttc
gtccagtacttcgagcaggcgacgccgatctccgtcatcgaggatctcgatctgggctcc
cggccggcctcgcgcagcggcgagcgcaccgtcgaggatctgcgggcgatcccgtgggtg
ttctcctggacccagtcgcggtgtatcctcccgggctggtacgccgtcgccgcggggatc
gacgcgtatctggaggacggtggctcgatggagaccatgcaggagatgtacgaccagtgg
ccgttcttccggaccacgctcgacaacgcggcgctctcgctgtcgcgaaccgaactcgag
atcgccgaccagtacgccgacctcgccgattcggagctccgcgagcggttcttcccgcgg
atcaccgacgagtaccagcgcgcgacggagctgatcaccgagatcggccagcgggaggac
ctgcacacgcgcgactggctcggcgagaacttggcgcggcgcaacccctacgtcgacccg
ctgaacgtgttacaggtctacctgctcgatcgcaaccaccggacggacgtcgaagagcgg
acgctgcggctgacggtgaagggaatcgccgccgggatgaagaacacgggctaa

DBGET integrated database retrieval system