KEGG   Haloterrigena turkmenica: Htur_5204Help
Entry
Htur_5204         CDS       T01154                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00564  Glycerophospholipid metabolism
htu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Htur_5204
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Htur_5204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox HI0933_like 3HCDH_N NAD_binding_8 ApbA
Motif
Other DBs
NCBI-ProteinID: ADB63835
UniProt: D2S388
LinkDB All DBs
Position
pHTUR04:93873..95147
Genome map
AA seq 424 aa AA seqDB search
MNSRSTHPDVLVIGGGATGTGLARDLALRGVDVTLAERDGLSAGASGRSHGLLHSGARYA
ESDPEGARECLEENRILRDIGGACVRETRGLFVQLAEDDPDYFEAKRAACEDVGISVDVI
GGETARDAVPGLSDEVERAMWVPDAVVVPSRLVAANAAAARDRGADILPHAPVTDMTVDD
GRIASVSLGGDAGRTIEPTYVVNATGAHAGRTAAMAGVTVPMRPTRGVMVSVDYDGLEPV
LNRCRDPADGDIVVPHEDEAVLGTTSVPVDDPDDYERADWEVERTIEECATILPAATEAE
RIRTWWGVRPLYEPEEDARGGRGISRGFHLLDHAADGSDESSPPALGSDGVDNFASIVGG
KLTTYRRMAEATADLVCERLGVDAESTTATTELPGASEPSTLDEYVREFDGQGPTDADLV
GAGR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtcgatcgacccatccggacgtcctcgtcatcggcggcggcgcgaccggcacg
ggactcgccagggacctcgcgctgcggggcgtagacgtgacgctggccgaacgcgacggg
ctctcggcgggcgcctccgggcgctcgcacggcctgctgcacagcggcgcccgctacgcc
gagagcgatcccgagggcgcccgcgagtgcctcgaggagaatcgcatcctccgcgatatc
ggcggcgcgtgcgtccgcgagacccgcgggctgttcgtccagttggccgaggacgatccg
gactacttcgaggcaaagcgcgcggcctgcgaggacgtcggaatttcggtcgacgtgatc
ggcggcgagacggctcgagacgcggttccgggactcagcgacgaggtcgaacgcgcgatg
tgggtccccgacgcggtcgtcgtcccgtcgcggctggtcgcggccaacgcggcggccgca
cgcgaccgcggcgccgacatcctgccgcacgcgcccgtcaccgacatgaccgtcgacgac
ggccgaatcgcgtcggtctcgctcggcggcgacgccgggaggaccatcgaaccgacctac
gtcgtgaacgcgacgggcgcccacgccggccgaaccgcggcgatggccggcgtcaccgtt
ccgatgcgcccgacgcggggcgtcatggtctcggtcgactacgacggcctcgagcccgtg
ctcaaccgctgtcgcgatccggcagacggcgacatcgtcgtcccccacgaggacgaggcc
gtgctgggaacgacgagcgttccggtcgacgatccggacgactacgagcgggccgactgg
gaggtcgagcgaacgatcgaggagtgtgcgacgatcctcccggccgccaccgaggcggaa
cggatccggacgtggtggggcgtgcggccgctgtacgaacccgaggaggacgctcgaggc
gggcgcgggatttcgcggggcttccatctgctcgatcacgccgccgacgggagcgatgaa
tcgtccccaccggcgctggggtccgacggcgtcgacaacttcgccagcatcgtcggcgga
aagctgacgacctaccgtcggatggccgaggcgaccgcggatctcgtctgcgaacgactg
ggcgtcgacgccgagtcgaccacggcgacgaccgaactcccgggcgcgtcggagccgtcg
acgctcgacgagtacgttcgcgagttcgacgggcaggggccgacggacgcggatctcgtc
ggcgccggtcgctga

DBGET integrated database retrieval system