KEGG   Helicobacter typhlonius: BN2458_PEG0350Help
Entry
BN2458_PEG0350    CDS       T04174                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B @ Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hty  Helicobacter typhlonius
Pathway
hty00970  Aminoacyl-tRNA biosynthesis
hty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hty00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN2458_PEG0350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hty03029]
    BN2458_PEG0350
Enzymes [BR:hty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN2458_PEG0350
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN2458_PEG0350
Mitochondrial biogenesis [BR:hty03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN2458_PEG0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Pox_I1
Motif
Other DBs
NCBI-ProteinID: CUU39237
UniProt: A0A099UDW8
LinkDB All DBs
Position
I:complement(300825..302249)
Genome map
AA seq 474 aa AA seqDB search
MSAYETIIGLEVHVQLNTKTKIFCFCATSFGDEPNKNVCPTCLGLPGALPVLNREAVKKA
ISFGTAINATINQNSVFARKNYFYPDLPKAYQISQFEIPIVGRGSIEIECNNQTKTIGVT
RAHLEEDAGKNIHENNYSKVDLNRACTPLLEIVSEPDMRSSDEAIAYLKKLHSIVRFLGI
SDANMQEGSFRCDANVSIRPKGDCKLYTRVEIKNLNSFKFIQKAIEYEVERQIEAWEEGK
YQSEVVQETRLFDTAKGITRSMRGKEEAADYRYFPDPDLLPVFIDENLMREGVKIPEMPD
EKRERYINTLGLKPYDAGVLTSSLELALYFESMLEEGASAKGALTWLTTELLGRLKGENT
LQTCGVDSKTLATLVKRIEEGKISGKSGKEILDVLMEKGGDVDSLIDSMGLAQINDDGAI
IAVIESVLSANADKVAEYKSGKDKLFGFFVGQVMKNSKGANPARVNELLKEKLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgtatgaaacgattatcggtttagaggtgcatgtccaactcaataccaaaaca
aaaattttttgcttttgcgcaacaagctttggtgatgagcctaacaaaaatgtttgcccc
acttgcttagggctacccggcgcactccccgtgcttaatcgcgaagcggtaaaaaaggcg
atttcctttggcactgcgattaatgcgactattaatcaaaactctgtctttgcacgcaaa
aactatttttacccagacttgccaaaagcctatcaaatcagtcaatttgagattcctatc
gtaggacgaggaagtattgaaattgaatgtaataaccaaacaaaaactatcggtgtaacg
cgtgcgcaccttgaagaagatgcaggtaaaaatatccacgaaaataattattcaaaagta
gatttaaatcgtgcctgcacgcctctactagaaattgtgagtgagcccgatatgcgaagt
tccgatgaggcaatagcctatcttaaaaagctgcattctattgtgcgatttcttggcata
agcgatgcaaatatgcaagaaggaagctttagatgtgatgcaaacgtttctattcgcccc
aaaggagattgcaaactctatacgcgtgtagagattaagaatcttaactcctttaaattt
atccaaaaagcgattgaatatgaggtagagagacaaattgaagcttgggaagagggaaaa
tatcaaagcgaagttgtgcaagaaactcgtctttttgacactgccaaaggcattactcgt
tcaatgcgtggcaaggaagaggcagctgattatcgctatttccctgaccctgaccttttg
cctgtttttattgatgagaatcttatgcgtgagggagtgaagattccagaaatgcccgat
gaaaaaagggagcgatatattaataccttaggacttaagccttatgatgcaggtgtgctt
acaagtagccttgagcttgcactttattttgaatctatgcttgaagaaggtgcgagcgca
aaaggtgctcttacttggcttactacagagcttttagggcgattaaagggtgaaaataca
ctgcaaacttgtggggtggattctaaaactttagccacacttgttaaacgcattgaggag
ggcaaaatcagcggaaaaagtggcaaagaaattttagatgtgcttatggaaaaaggaggc
gatgtagatagcctcatagattctatgggattagcccaaattaatgatgatggcgcaatt
attgcagttatagaatctgtgttaagcgctaatgccgacaaggtcgcggaatacaaaagt
ggcaaagacaaactctttggattctttgtcgggcaagtgatgaaaaactctaaaggcgca
aatccagcaagggtaaatgagcttttaaaagaaaaattagggtag

DBGET integrated database retrieval system