KEGG   Helicobacter typhlonius: BN2458_PEG0931Help
Entry
BN2458_PEG0931    CDS       T04174                                 

Definition
(GenBank) Type II restriction enzyme MjaIII
Organism
hty  Helicobacter typhlonius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C PAC3
Motif
Other DBs
NCBI-ProteinID: CUU39816
UniProt: A0A099UH29
LinkDB All DBs
Position
I:834295..835125
Genome map
AA seq 276 aa AA seqDB search
MKNNLPFDEFLQSLQTSNRTLDFFVDWQKCLKNKNEISIALNHLNFLLGKDTQELKIYIK
SLFEEYPKAFSVLNILIAVRDRNDLVLDVDGNFYPLNSYFENCEKIYEFICQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMETYLGSLFANAQLSFEEQVDIRNFKDLHQ
AFGDDIKKFDFVIFGKDTNYFIESNFYAGGGSKLNEVARAYQDLAPKFEIFSNYEFIWIT
DGKGWLSAKNKLQEAYKYVEIYNLSNIGNFIQKVRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatctaccttttgatgaatttttacaaagccttcaaacaagcaatagaact
ttggatttttttgtagattggcaaaaatgtctcaaaaataaaaatgagataagcatagct
ttaaatcatttgaattttttacttggaaaagatacacaagagctaaaaatttatattaaa
agcctttttgaagaatatcccaaagcttttagtgttttaaatattctcattgctgtgaga
gatagaaatgatttggtgcttgatgttgatggtaatttttaccctttaaattcttatttt
gaaaattgtgaaaaaatttatgagttcatttgtcaaacaggtttggagcaaattttttgc
aatagaaatattaaagatttaaatgatttcgtttttggtatagaagttgggcttgatagt
aatgcgagaaaaaatcgtagcggaaaggctatggaaacttatcttggcagtctttttgct
aatgctcaattaagtttcgaagaacaagttgatattagaaattttaaggatttacaccaa
gcttttggagatgatattaaaaagtttgattttgttatttttggcaaagatacaaattat
tttatagaatctaacttttatgcaggtggtggaagtaagcttaatgaagtagcgagagcc
tatcaagatttagctccaaaatttgaaatattttcaaattatgaatttatttggataact
gatggcaaaggttggttgagtgccaaaaacaaacttcaagaagcttataaatatgtagaa
atctataatttaagcaatataggtaattttatacaaaaggttagaaaatga

DBGET integrated database retrieval system