KEGG   Helicobacter typhlonius: BN2458_PEG1223Help
Entry
BN2458_PEG1223    CDS       T04174                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hty  Helicobacter typhlonius
Pathway
hty00473  D-Alanine metabolism
hty00550  Peptidoglycan biosynthesis
hty01100  Metabolic pathways
hty01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN2458_PEG1223
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN2458_PEG1223
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BN2458_PEG1223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hty01011]
    BN2458_PEG1223
Enzymes [BR:hty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN2458_PEG1223
Peptidoglycan biosynthesis and degradation proteins [BR:hty01011]
 Precursor biosynthesis
  Amino acid ligase
   BN2458_PEG1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CUU40108
UniProt: A0A099UCH5
LinkDB All DBs
Position
I:complement(1096119..1097186)
Genome map
AA seq 355 aa AA seqDB search
MKYDVLFGGVSFEHEISIVSAIAIKKILGEKIESFIFLDSEHRFYLIPADSMKSKFFSSG
AYKKCIELFVGQGGFYKKSFFGLNAITPHIVLNLIHGADGEDGSISALLDFYKIAFIGPR
TESSVMSFNKALTKLFARERGVKVLEYALLTREDSKNVEDKLSNLKYPLILKPARLGSSI
GVSVVNEPKEIEYAMDLAFEYDDMILAEHFTSGIKEYNLAGCKVKSGAGSEFAYSIIEEP
SKKELLDFEHKYLDFSRTSQVLKADISPELEAKIKESFTALYENAFEGALIRCDFFVIDN
EVYLNEINPIPGSMANYLFEDFVSMVDSLAYSLPKKHNINVSYKYIEQIHHAKGK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgatgtgctatttggtggcgtgagttttgaacacgagattagcattgtgagt
gcgattgccataaaaaagattctaggtgagaaaatagaatcctttatttttcttgatagt
gagcatagattctatcttattcctgcagattctatgaagtcaaaattttttagctctggc
gcgtataagaaatgtatagaattattcgtagggcagggaggattctataaaaagagcttt
tttggattaaatgctatcacgcctcatattgtgctcaatcttattcacggcgcagatggt
gaggacggaagcataagcgcattgcttgatttttataaaattgcatttatcggtcctcgc
acagaatctagcgtgatgagtttcaataaggctctcacaaagctttttgcgcgtgaaagg
ggtgtaaaggttttagaatacgcactcttaacgcgtgaagattctaaaaatgtggaggat
aaattaagcaatcttaagtatccattgattctaaaacccgcacgacttggtagctctatt
ggcgtgagtgtggtaaatgaaccaaaggaaatagaatatgctatggatttggcttttgaa
tatgatgatatgattttggcagagcatttcacaagtggcattaaagaatataatctcgca
gggtgcaaggtgaaaagtggtgcagggagcgagtttgcatactctatcatcgaggagcca
agcaaaaaagaattgcttgattttgagcataaatatttggatttctcgcgcacatcgcag
gtgctaaaggcagatattagcccagagcttgaagctaagataaaagagagttttactgca
ttgtatgaaaatgcttttgagggggcattaatacgatgtgatttttttgtgattgataat
gaggtgtatttgaatgaaattaaccccattcctggttctatggcgaattatttgtttgag
gattttgtctctatggtagatagtctagcatatagtttgccaaaaaagcataatatcaat
gtgagttataaatacattgagcagattcatcacgcaaaaggaaaataa

DBGET integrated database retrieval system