KEGG   Helicobacter typhlonius: BN2458_PEG1333Help
Entry
BN2458_PEG1333    CDS       T04174                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hty  Helicobacter typhlonius
Brite
KEGG Orthology (KO) [BR:hty00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hty03012]
    BN2458_PEG1333
   03029 Mitochondrial biogenesis [BR:hty03029]
    BN2458_PEG1333
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hty04147]
    BN2458_PEG1333
Translation factors [BR:hty03012]
 Eukaryotic Type
  Elongation factors
   BN2458_PEG1333
 Prokaryotic Type
   BN2458_PEG1333
Mitochondrial biogenesis [BR:hty03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN2458_PEG1333
Exosome [BR:hty04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN2458_PEG1333
  Exosomal proteins of breast cancer cells
   BN2458_PEG1333
  Exosomal proteins of colorectal cancer cells
   BN2458_PEG1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CUU40218
UniProt: A0A099UDF8
LinkDB All DBs
Position
I:complement(1195355..1196554)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFVKNKPHVNVGTIGHVDHGKTTLSAAISAVLATKGLAELKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVHYIVVFLNKQDMVDDAELLELVEMEVRELLSQYDFPGDDTPIIAGSALKALE
EAKAGNVGEWGEKVLKLMEEVDKYIPTPQRDTEKTFLMPVEDVFSIAGRGTVVTGRVERG
VVQVGDEVEIVGIRDTQKTTVTGVEMFRKELDKGEAGDNVGILLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFKGYRPQFYVRTTDVTGSIELPSGVEMVMPGD
NVKITVELIAPVALEDGTRFAIREGGRTVGSGVVTKIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgtgaaaaacaaacctcacgtaaatgtgggaacaatcgggcat
gttgatcatggtaaaacaactttgagtgcagctatttctgctgtgttggcaactaaaggt
cttgcagaattgaaagactatgataacattgataacgcgccagaggaaaaggaaagaggt
attactatcgcgacttctcatattgaatatgagacagaaaatcgccactacgcgcacgtg
gattgccccggacacgctgactatgttaaaaatatgattacaggtgcagctcaaatggac
ggagcaattcttgttgtttctgccgcagatggtcctatgccacaaacacgtgagcatatc
ttgttgtctcgccaagtaggtgtgcattacatcgttgtatttttaaataaacaagatatg
gttgatgatgctgaattgcttgagcttgtggaaatggaagtgcgtgaattgcttagtcaa
tatgattttcccggagatgatactcctatcattgcaggttctgctctcaaagcacttgaa
gaagcaaaagcaggtaatgtaggtgaatggggtgaaaaagtattaaaattaatggaagaa
gttgataaatatattccaactccacaacgtgatactgaaaaaacattccttatgcctgta
gaagatgtattctcaatcgctggtcgtggaacggttgtaacaggaagagtagaaagaggt
gttgtgcaagtaggcgatgaagtagaaatcgtaggaatccgcgacactcaaaaaacaaca
gttacaggcgttgaaatgtttagaaaagagcttgataaaggtgaggcaggagataatgtc
ggtattttgttgcgaggaacaaaaaaagaagaagtagaaagaggtatggttctttgtaag
cccggctcaattactccacataagaaatttgagggcgagatttatgtgctttcaaaagag
gagggcggacgccatacaccattctttaagggataccgcccacaattctatgtgcgaaca
actgatgttaccggttctattgagctcccaagcggtgtagaaatggttatgcctggtgat
aatgtaaaaatcacagtggagcttatcgcacctgtagcacttgaagatgggactcgtttt
gcaattcgtgaaggtggtagaacggttggttcaggtgttgtaaccaaaatcatagaataa

DBGET integrated database retrieval system