KEGG   Helicobacter typhlonius: BN2458_PEG2051Help
Entry
BN2458_PEG2051    CDS       T04174                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hty  Helicobacter typhlonius
Pathway
hty00620  Pyruvate metabolism
hty00680  Methane metabolism
hty01100  Metabolic pathways
hty01120  Microbial metabolism in diverse environments
hty01200  Carbon metabolism
Module
hty_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN2458_PEG2051
  09102 Energy metabolism
   00680 Methane metabolism
    BN2458_PEG2051
Enzymes [BR:hty01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BN2458_PEG2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CUU40934
UniProt: A0A0S4PYT3
LinkDB All DBs
Position
I:1850375..1853071
Genome map
AA seq 898 aa AA seqDB search
MPKNSHKDSKVPSTSSALLQPSQIEFVFESITSLLQTIDCELKNTFITIKESIEKQDNKT
LLSTLSTLKEQNKILPIIKAFTLYHMLLNIIEELNISGNTEANKLSQALQELNKEGYEMP
EILEVLEHLRFYPVFTAHPTESRRRTFLEAHHQMSENIKDIFAYNDEKAKNQLLCRLKLL
WQTHLVRSEKMEILYELDNLLYIIESSVLESAAQVLTYIQNLLDKPLEASPITLGSWVGG
DRDGNPYVSNEILTKVMKIAHKAIIESYISKCDRLIRELSLSIDFVKPSRALMLSIQSQI
HELPSSEATLFAKEPFRAKLYLMRKKLQNRLIAINAPDNIDFTYADSKELLDDIDLLMES
LDPLSAQGLKEFRHLVLLGGFHLLRLDFREHRDVVLNTISEIFCLLGLSDSDFKDLNENK
KCEILNLALNKKYDLNIIIQQLSAQSQRLVGAFLRIQWARKHISRHILQSFIVSMSTQAS
DLLCVLWFAKQSGLWKAGKQQEAKSGKAYISITPLFETIDDLQRAKNIIRILHTNAHYRQ
YLYDNNNTQEVMVGYSDSSKDGGIFASNYNLHRAITSLTHLQDELGISISFFHGRGGSVS
RGGGSLEEALLSSAPKSVHNTLKTTEQGEMISAKYLNKHIATKNFSSTLGALLKKSVADT
FCMNGACESDAHIMALLEPVSIGSFESYRALVYEDKGFMSYFKMATPIAFIQNLNLGSRP
SKRKDSQKVEDLRAIPWVFAWTQNRAIIPAWYGLGSGLSRVDKNALKDCYELSLFFKTTI
DNISQAMLKVDLDIAKLYSTFVTDKAVRERIWECIYSQYNLTLENLLYLRGEHRLLDSEM
AIRESILLRRPYLSVLNLTQIELIKQYQSSPYEKAKGRILEQIHATIVGIAQGIRNTG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaactcacataaagactctaaagtcccatctactagctccgccctgcttcaa
ccctcgcagattgaatttgtctttgaaagcattacgagtttgctccaaacgattgattgt
gagctaaaaaatacctttataacgataaaagaatccatcgaaaagcaagataataaaacg
cttctatccacactctccacactcaaagagcaaaacaaaatactgccgataataaaggct
tttaccctctatcatatgctccttaatatcatcgaggagctcaatatcagtggcaacaca
gaggcaaataaactctctcaagccctgcaagagcttaacaaagagggttatgaaatgcct
gaaatactagaagttttggagcatttaagattctatcctgtctttaccgctcaccccaca
gaatctcgccgccgcacattcctagaggcacatcatcaaatgagcgaaaacatcaaggat
attttcgcatacaatgacgaaaaagcaaaaaatcagctcctctgtcggctaaaactcctc
tggcaaacacatttggtgcgtagtgaaaaaatggagattctctatgaacttgataattta
ctttatatcattgaaagttccgttttagaatctgccgcacaggtgcttacatacatacaa
aacttgcttgataaaccgctagaagcctctcctattaccttaggaagctgggtaggaggc
gatagagatggtaacccctatgtaagtaatgagatactcacaaaagtaatgaaaattgcg
cataaggcgattattgaatcctacattagcaagtgcgataggcttatacgcgaactctcg
ctctcaattgactttgtcaagccctcacgcgcacttatgctctctatccaaagccaaata
cacgaacttcctagtagcgaggcaacactctttgcaaaagagccttttcgcgccaagctc
taccttatgcgcaaaaaactacaaaatcgcctcatagccattaatgcgccggataatatt
gacttcacttacgcagattctaaagaacttttagatgatattgatttgcttatggaatct
ttagaccctctctctgcacaaggactgaaagaatttcgccatttggtgcttttgggagga
tttcatttattgcgccttgactttagggagcatagagatgtggtattaaacacgattagc
gagattttttgcctactaggcttaagtgatagcgactttaaagacttgaatgaaaacaaa
aagtgcgagattctcaacctcgccttgaataaaaaatatgatttaaatattattattcaa
cagctaagtgcgcagtcgcagcggcttgtaggagcatttttacgcatacaatgggcaaga
aaacacatctctaggcatattttgcaaagctttatcgtctctatgagcacacaagcaagt
gatttgctctgtgtgctgtggtttgccaaacaaagcggattgtggaaagcaggaaagcaa
caagaggctaaaagcggcaaggcgtatatttctattacaccactttttgagaccatagat
gatttgcagagggcgaaaaacattatccgcatactacacacaaatgcgcattataggcaa
tatctctatgacaataataacacgcaagaagttatggtgggctattcggattcaagcaag
gacggggggatttttgcgagtaattacaacctccaccgcgccattacgagccttacgcat
ttgcaagatgaactaggcattagcattagcttttttcacggacgaggcggaagcgtgtct
cgtggcggaggaagcctagaagaagcactcctctcgtctgcaccaaaaagtgtgcataac
acgcttaagacaaccgaacagggcgaaatgataagcgcaaaatacctcaataaacacatt
gctacaaagaatttttcaagcacattaggtgctttactcaaaaagagtgtggcggatact
ttttgcatgaatggcgcgtgtgagagtgatgcgcatattatggcattgcttgagcctgta
tctattggctcatttgaaagctaccgcgcattagtctatgaagacaagggctttatgagc
tattttaaaatggcaacacccatagcttttatacaaaatcttaatctcggctcacgcccg
agcaaacgcaaagattcgcaaaaagtagaggatttacgcgcaattccgtgggtatttgcc
tggacgcaaaatcgcgccattatccctgcgtggtatgggctaggcagtggcttaagtcgt
gtggataaaaatgcgcttaaagattgctatgagctgtctttatttttcaaaactaccatt
gataatatctcacaggctatgcttaaagtggatttagacattgccaagctttatagcaca
tttgtaacagataaagcggtgcgggagcgcatttgggagtgcatttatagtcaatataat
ctcacacttgaaaatcttttgtatttgcgtggagagcataggctactagattctgaaatg
gcaattcgcgaatctatcctcttgcgtaggccctatttgagtgtacttaacctcacgcaa
atcgagcttatcaagcaatatcaaagttccccatacgagaaagcaaagggcagaatccta
gagcaaatccacgccacaattgtaggtattgcgcaaggcattcgcaacacagggtaa

DBGET integrated database retrieval system