KEGG   Humibacter sp. BT305: DVJ78_08915Help
Entry
DVJ78_08915       CDS       T05558                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hum  Humibacter sp. BT305
Pathway
hum00473  D-Alanine metabolism
hum00550  Peptidoglycan biosynthesis
hum01100  Metabolic pathways
hum01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DVJ78_08915
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DVJ78_08915
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DVJ78_08915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hum01011]
    DVJ78_08915
Enzymes [BR:hum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DVJ78_08915
Peptidoglycan biosynthesis and degradation proteins [BR:hum01011]
 Precursor biosynthesis
  Amino acid ligase
   DVJ78_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AXH35511
UniProt: A0A345JY22
LinkDB All DBs
Position
1887064..1888155
Genome map
AA seq 363 aa AA seqDB search
MPDRLRVALVFGGRSSEHSISCATAGGVLEAIDRSRYEVIPVGITRDGAFVLEQDDPSRF
ALDATRLPEVVDNGTRIQWPDSVSSRELTVTEARGAAPRSLGAIDVVFPILHGPYGEDGT
IQGLFELLGLPYVGSGVLASALGMDKHFTKTVLEKAGIAVAPWQTVTAQQWASSASSVTA
SAEALGLPVFVKPARAGSSVGVTKVSAWDELPAAIDIALHEDSRILIESAIVGREVECGV
LSGRGGAEPSVSVAGEIVMTAREFYDFEAKYLDAPGVDLVCPASLTDDELSRMQELAARA
FTAIDGAGLARVDFFLTPSGEFVINEINTMPGFTPISMFPKCWIASGVSYPALIDELLAL
ALE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacagactcagggtcgctctcgtcttcggcggacgatcgagcgagcactcgatc
agctgcgccacggcgggcggagtgctggaggcgatcgataggtcgcgctacgaggtgatc
cccgtgggcatcacccgcgacggcgccttcgtgctggagcaggacgacccctcgcgcttc
gcgctcgacgcgacacgccttcccgaggtcgtcgacaacggcacgcgcatccagtggccc
gacagcgtctcctcccgcgagctgacggtgacggaggcgcggggcgcggctccgcgctcg
ctcggcgccatcgacgtggtgttcccgatcctgcacggcccctacggggaggacggcacg
atccagggcctcttcgagctgctcgggctgccgtacgtgggctcgggcgtgctcgcctcg
gcgctcggcatggacaagcacttcaccaagaccgtgctcgagaaggcggggatcgcggtc
gcgccctggcagaccgtgacggcccagcagtgggcgtcctccgcgtcgtcggtgaccgcg
tcggccgaggcgctcgggctgcccgtcttcgtcaagcccgcgcgggccggctcgtcggtc
ggcgtcacgaaggtctccgcgtgggatgagctgcccgccgcgatcgacatcgcgctgcac
gaggacagccgcatcctgatcgagagcgccatcgtcgggcgggaggtggagtgcggtgtg
ctctcgggccgcgggggagcggagcccagcgtgtcggtggcgggcgagatcgtgatgacc
gctcgcgagttctacgacttcgaggcgaagtacctcgacgctcccggggtcgacctggtg
tgccccgcatccctcaccgacgacgagctgtcgcggatgcaggagctcgccgcgcgcgcg
ttcaccgcgatcgacggcgcgggcctggcgcgggtcgacttcttcctgacgccgtcgggc
gagttcgtcatcaacgagatcaacacgatgccggggttcacccccatctcgatgttcccc
aagtgctggatcgcgagcggcgtctcctaccccgccctcatcgacgagctcctcgcgctc
gccctcgagtag

DBGET integrated database retrieval system