KEGG   Humibacter sp. BT305: DVJ78_11245Help
Entry
DVJ78_11245       CDS       T05558                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
hum  Humibacter sp. BT305
Pathway
hum00500  Starch and sucrose metabolism
hum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DVJ78_11245
Enzymes [BR:hum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DVJ78_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AXH35905
LinkDB All DBs
Position
complement(2397127..2399559)
Genome map
AA seq 810 aa AA seqDB search
MHRRILSSALAVGIVAAGLGFVPIPSATAAPLVPLAPGAPGVAATWTSGDKHGLGTAVSD
ASKVWYTLGSGTTTEVFYPTVDRPQVQDLQFVVTDGVSRTYVERDDTVHETTLVDPEALE
YRQTDTAKDGSFRITKTYVTSPGRPTLLIATRFEQLTGTTPLHLYVLFNPSAGGDGNANR
GSTVDGMLTSQGGPSSAALASSSGFGDTTTGYSGTSSDPYRQLTADHRLSTLYGAAAADG
NVVQSAEIAVGRDTSFTLALGFGSTLDEAKGSAAGALLDGFAATESAYTAGWHGYLASLS
PAPSSVAGTPLETQYDVAVMTLRAHEDKTVRGAFVASLSVPWGQAVPGTMANPGYHAIWA
RDLYQVATALLAAGDRAGASRALDYMLNVQQRADGSMPHNTMVDGSDTGLTGIQLDEVAF
PAVLASMLGRSDSATWAKLKLSADYLVSHGPSTPQERWEEQAGFSPSTIAAEIAGLVASA
DIAVKNGDRASATRYLDTADLWRASLESWTVTHTGSIGTPHYERIDPIGAPDAGTTVCDT
NGAGCTDARDLVDGGFLELVRLGIRSADDPTIAASVAVVDAQLRVDTPSGAMWRRYNRDG
YGEHADGSPFNGTAGGIGRPWPVLAGERGQYELANGRDAMPYLRSMAATANDAYMIPEQV
WDTADTGRFTAGEATDSAAPLAWAMAQYVRLAQSISAGRNVDTPAVVAARYATGVEATFR
ANATTTWGESVYVVGSIPALGSWDTSKAIRLSSAAYPDWAVEVALPAGVTVEYKYIRKSA
DGKVTWESGANRVVTLPGSGSPVYRDTWRR
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcgcatcctctcctctgctctcgccgtcggcatcgtggccgccggcctcggg
ttcgtcccgatcccgtcggcgaccgccgcgccgctggtccccctcgcgcccggcgccccc
ggtgtcgccgccacctggaccagcggcgacaagcacggcctcggcaccgccgtctccgac
gcgtcgaaggtctggtacacactgggatccgggaccaccaccgaggtgttctatcccacg
gtcgaccgtcctcaggtccaggacctccagttcgtcgtcaccgacggcgtctcgcgcacc
tacgtcgagcgcgacgacacggtgcacgagaccacgctggtcgaccccgaggcgctcgag
taccggcagaccgacaccgcgaaggacggatcgttccgcatcacgaagacgtacgtgacg
agccccggtcggcccacgctcctcatcgccacgcgcttcgagcagctcaccggaacgacc
ccgctgcacctctacgtgctcttcaacccctccgccggcggcgacggcaacgccaaccgc
ggcagcaccgtcgacgggatgctgacctcccagggcggaccgagctcggccgcgctcgcc
tcctcgtccgggttcggcgacaccacgaccggctacagcgggacgagcagcgatccgtac
cgccagctgacggccgatcaccggctgtcgacgctctacggcgcggcggccgccgacggc
aacgtcgtccagtccgccgagatcgccgtcggccgcgacacgagcttcaccctcgccctc
gggttcgggtcgaccctcgacgaggcgaagggctcggccgccggagcactgctggacggt
ttcgccgccacggagagcgcgtacacggccgggtggcacggctacctcgcctccctctcc
cccgccccgtcgagcgtagcggggacgccgctcgagacccagtacgacgtcgccgtgatg
acgctccgcgcccacgaggacaagaccgtccgcggcgcgttcgtcgcctcgctctcggtc
ccctggggccaggccgtgcccgggacgatggcgaaccccggataccacgccatctgggct
cgtgacctgtatcaggtcgccaccgcgctcctcgccgcgggcgatcgcgctggcgcgtct
cgtgcgctcgactacatgctgaacgtgcagcagcgcgccgacggcagcatgccgcacaac
accatggtcgacggaagcgacaccgggctgaccggcattcagctcgacgaggtcgccttc
cccgctgtgctggcatcgatgctcggacgctccgacagcgccacctgggcgaagctcaag
ctctcggctgactacctcgtgtcgcacgggccgtcaacgccccaggagcgctgggaggag
caggccggcttctccccctccaccatcgccgccgagatcgccgggctcgtcgcgtccgcc
gacatcgccgtcaagaacggcgaccgggcgtcggcgacccgctacctcgacaccgccgac
ctctggcgcgcgagcctcgagtcgtggaccgtgacgcacaccgggtcgatcggaaccccg
cattacgagcgcatcgaccccatcggcgccccggatgcgggcacaaccgtctgcgacacg
aacggcgctggatgcacagacgctcgcgacctcgtcgacggcggattcctcgagctcgtc
cggttgggcatccgctcggccgacgacccgaccatcgccgcctcggtcgcggtcgtcgac
gcccagcttcgcgtcgacacgccctcgggcgcgatgtggcggcggtacaaccgggacggg
tacggcgagcatgccgacggctcccccttcaacggcacggcgggcgggatcggccgaccg
tggcccgtcctcgccggcgagcgtgggcagtacgagctcgcgaacggccgcgacgcgatg
ccgtatctccgctcgatggcggcgacggcgaacgacgcgtacatgatccccgagcaggtg
tgggacaccgccgacaccggccgcttcaccgcgggcgaggccaccgattccgccgctccc
ctggcctgggcgatggcgcagtacgtcaggctcgcgcagtcgatcagtgccggccgcaac
gtcgacacacccgccgtcgtcgcagcccgctacgcgacgggcgtcgaggccaccttccgc
gcgaacgcgaccacgacctggggcgagagcgtctacgtcgtcgggagcatccccgcgctg
ggctcctgggacacctcgaaggcgatccggctctcgagcgcggcctatccggactgggcc
gtcgaggtggcgctccccgcgggcgtcaccgtcgagtacaagtacatccggaagtccgcc
gacgggaaggtgacgtgggagtccggcgcgaaccgggtcgtgaccctgcccggctccggg
agcccggtgtaccgcgatacctggcgccgctga

DBGET integrated database retrieval system