KEGG   Humibacter sp. BT305: DVJ78_11585Help
Entry
DVJ78_11585       CDS       T05558                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
hum  Humibacter sp. BT305
Pathway
hum00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hum01100  Metabolic pathways
hum01110  Biosynthesis of secondary metabolites
hum01130  Biosynthesis of antibiotics
hum01230  Biosynthesis of amino acids
hum02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DVJ78_11585
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    DVJ78_11585
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DVJ78_11585
Enzymes [BR:hum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DVJ78_11585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AXH35965
UniProt: A0A345JZC6
LinkDB All DBs
Position
2467486..2469003
Genome map
AA seq 505 aa AA seqDB search
MSSTTTREEFDALRPEHRLIPVIRELFADGETPVGLHRKVADGRPGTFLLESAGQGGVWS
RFSFVGASSFGILTEDDGAARWIDLGLSLARAFPSGMPEGPLSALSALYSQWSTPDLEGH
PPLTGGLVGFIGWEAVRQLEHLPDAPPADFALPSQGLAFVSELVVVDHQRGTVQLIAAVL
NDDPDVDGWDDAQARLDRLQAAVAQPAEARLDEVDMTVVREPERRTRREDFLTAVDEAKE
YIRDGDIFQVVISQRFDLECTASPLDVYRVLRTLNPSPYLYLLTMIDASGAGYDIVGSSP
EALVKVQSGRAHTHPIAGSRPRGRTVQDDVDLEHELLDDEKEKAEHLMLVDLARNDLLKV
CRADSVEVTEFMRVERFSHIMHIVSSVEGELRDGVDAIDVFRATFPAGTLSGAPKPRALE
IIDELEPAQRGLYGGVVGYFGFGGDADLAIAIRTATIRDGVAHVQAGGGLVADSVPQLEF
EESQNKAAAPLRAVAVANAMTRVAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccaccacgacacgcgaggagttcgacgccctccggcccgagcaccggctgatc
ccggtcatccgggagctcttcgccgacggcgagaccccggtgggcctccaccggaaggtc
gccgacggccgaccgggcacgttcctcctcgagtcggccggacagggcggcgtctggtcg
cgcttctccttcgtcggcgcgtcgagcttcggcatcctcaccgaggacgacggcgccgcg
cgctggatcgacctgggtctcagcctggccagggcgttcccgtcgggcatgcccgaggga
cccctctcggccctctcggccctgtactcgcagtggagcacgcccgacctggaggggcac
cctccgctgacgggaggcctcgtcggattcatcggctgggaggccgtgcgccagctcgag
cacctcccggacgctccgcccgccgacttcgcgctgcccagccagggcctcgccttcgtg
tccgagctcgtcgtcgtcgaccaccagcgcggcaccgtgcagctcatcgccgccgtcctg
aacgacgacccggatgtcgacggctgggacgacgcgcaggcccggctcgaccgcctgcag
gcggccgtcgcgcagcccgccgaggcccgcctcgacgaggtcgacatgaccgtggtgaga
gagcccgagcgccgcaccaggcgggaggacttcctcacggccgtcgacgaggcgaaggag
tacatccgcgacggcgacatcttccaggtggtgatctcgcagcggttcgacctcgagtgc
acggccagcccgctcgacgtctaccgggtgctccgcacgctcaacccgagcccgtacctc
tacctgctcacgatgatcgacgcctcgggcgccggctacgacatcgtcggatcgagcccc
gaggccctggtgaaggtgcagtcgggccgcgcccacacgcatccgatcgccggatcgcgc
cctcgcggccgcaccgtccaagacgacgtcgacctcgagcacgagctgctcgacgacgag
aaggagaaggccgagcacctgatgctggtcgacctcgcccggaacgacctgctcaaggtc
tgccgcgccgacagcgtcgaggtcaccgagttcatgcgggtcgagcggttcagccacatc
atgcacatcgtctcgagcgtcgagggggagctccgcgacggcgtcgacgcgatcgacgtc
ttccgggccaccttcccggcgggcaccctctcgggcgcgccgaagccgcgtgcgctcgag
atcatcgacgagctcgagcccgcccagcgcggcctctacggcggcgtcgtcggctacttc
ggcttcggcggcgacgccgacctcgcgatcgcgatccgcaccgcgaccatccgcgacggg
gtcgcgcacgtgcaggcgggcggcggtctcgtcgccgactccgtgccgcagctcgagttc
gaggagtcgcagaacaaggcggccgcaccgctgcgcgcggtggccgtcgcgaacgcgatg
acccgggtggccggatga

DBGET integrated database retrieval system