KEGG   Humibacter sp. BT305: DVJ78_15770Help
Entry
DVJ78_15770       CDS       T05558                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hum  Humibacter sp. BT305
Pathway
hum00020  Citrate cycle (TCA cycle)
hum00480  Glutathione metabolism
hum01100  Metabolic pathways
hum01110  Biosynthesis of secondary metabolites
hum01120  Microbial metabolism in diverse environments
hum01130  Biosynthesis of antibiotics
hum01200  Carbon metabolism
hum01210  2-Oxocarboxylic acid metabolism
hum01230  Biosynthesis of amino acids
Module
hum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hum_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DVJ78_15770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DVJ78_15770
Enzymes [BR:hum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DVJ78_15770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: AXH36673
UniProt: A0A345K1D4
LinkDB All DBs
Position
complement(3319010..3320227)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDVNLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTLTFTPKDGSEPQSFEVFESPGSGVAMG
MYNLDESIRDFARASLNYGLARNYPVYLSTKNTILKAYDGRFKDLFAEVFEDEFRAEFEA
RGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGS
IVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTRGLQHRGKLDGNQELIDFASTLED
VVIKTVESGKMTKDLALLVGPEQEYQTTEEFLATLAENLKTRIEG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaagatcaaggttgagggcaccgtcgtcgagctcgacggcgacgagatgacgcga
atcatctggcagtccatcaaggacactctgatccacccgtacctcgacgtgaacctcgag
tactacgacctcggcatcgagaagcgcgacgagaccgacgaccagatcaccatcgacgcc
gccaacgcgatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtagaggagttcggcctcaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcgtcatcttccgcgagccgatcatcatctccaacatcccgcgtctg
gtgccgggctggaacaagccgatcatcgtcggtcgtcacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctgaccctgacgttcaccccgaaggac
ggctccgagccccagtcgttcgaggtgttcgagtcgcccggcagcggtgtcgcgatgggc
atgtacaacctcgacgagtcgatccgcgacttcgcccgcgcgtcgctcaactacggcctc
gcccgcaactacccggtctacctgtcgaccaagaacacgatcctcaaggcctacgacggc
cggttcaaggacctcttcgccgaggtcttcgaggacgagttccgcgccgagttcgaggcc
cgcggcctgacctacgagcaccggctcatcgacgacatggtcgcttcctcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgacgtccagagcgacaccgtg
gcgcaggggttcggctcgctcggtctcatgacctccgtgctcaccacccccgacggctcc
atcgtcgaggccgaggccgcccacggcaccgtcacccgccactaccgtcagcaccaggcg
ggcaagcccacgtcgaccaacccgatcgcctcgatcttcgcctggacccgcggtctccag
caccgtggcaagctcgacggcaaccaggagctcatcgacttcgcgtcgaccctcgaggac
gtcgtcatcaagacggtcgagagcgggaagatgacgaaggacctcgccctcctcgtcggc
cccgagcaggagtaccagaccaccgaggagttcctcgcgacgctggccgagaacctcaag
acccgcatcgagggctga

DBGET integrated database retrieval system