KEGG   Humibacter sp. BT305: DVJ78_18245Help
Entry
DVJ78_18245       CDS       T05558                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
hum  Humibacter sp. BT305
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: AXH37518
UniProt: A0A345K3S9
LinkDB All DBs
Position
unnamed1:61137..62138
Genome map
AA seq 333 aa AA seqDB search
MSDLPAGLCPPEVALARLANTISRPGALPGGSLYEPEWDGFRLVVVRDADVTLWSRQGKD
LTRHFPDLAAAAREQLPEGCVVEGEAVVWARDRLDFDALQKRLTTSPAAVQRLAHQWPAS
YVAFDLLAVDGQDARSLPLRDRRALLEQLAQDWVPPLNLSPATADYDEAVAWFEQLHTAG
IEGLVVKGAGDRYSGGVRQWVKVKHRDTLDVICAAVIGPAHQPQELVVGLPVDGELRIVG
RSTPLRVAPARALGRLLRPAVGEGHPWPAQIKPGALDRFGNSGRELVDLTLVKPVVVEIS
ADVAWSGRSFRHAVRYLRARPELDPAELLERER
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcccggcagggctgtgcccgcctgaggtcgctctggctcgcctggccaat
acgatctctagaccgggcgcgctgcccggtgggagcctgtacgagcccgagtgggacggg
ttccgtctcgtcgtcgtccgcgacgccgacgtgacgctgtggtctcgtcagggcaaggat
ctcactcggcacttcccggatctcgcggcggccgcgagggagcagctgcccgaggggtgc
gtcgtcgaaggtgaagcggtcgtgtgggcccgcgatcgactggactttgacgcgctgcag
aagcggctcaccaccagccctgccgcggtgcagcgcctcgcccaccagtggccggcgtcc
tatgtggcgttcgacctcctcgctgtcgacggccaggacgcgcgatcgctaccgctgcgc
gatcgccgggccctcctcgagcagcttgcccaggactgggtcccgcctctgaatctctcg
cctgccaccgcggattatgacgaggcggtggcctggttcgagcagctgcacacggccggg
atcgaagggctcgtcgtcaagggcgccggcgaccggtacagcgggggagtgcggcagtgg
gtgaaggtcaagcaccgagacaccctcgacgtgatctgcgccgccgtcatcggccccgcc
catcagccccaggagctcgtcgtcggcctgcccgtcgatggagagctgcggatcgtgggc
cgcagcacgccgctgcgcgtggcgccggcccgcgcgcttggacggctgctgcggccggcg
gtgggcgaggggcatccctggccggcgcagatcaagcccggcgccctcgacaggttcggc
aacagcggccgcgagctcgtcgacctcactctcgtcaagccggtcgtggtcgagatctcg
gccgacgtcgcctggtccggtcggtccttccggcacgccgtccgctacctgcgagctcga
cccgagctcgacccggctgagctcctcgaacgggagcgctga

DBGET integrated database retrieval system