KEGG   Halorhabdus utahensis: Huta_1442Help
Entry
Huta_1442         CDS       T00971                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
hut  Halorhabdus utahensis
Brite
KEGG Orthology (KO) [BR:hut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Huta_1442
Enzymes [BR:hut01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Huta_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACV11618
UniProt: C7NNU3
LinkDB All DBs
Position
1410989..1412110
Genome map
AA seq 373 aa AA seqDB search
MDEDRDWAAVLGVRSAEVDSVLAAFEESVFEGRRYRHLSAARHGIERGTAIVDGTVIRGF
PSIPRTLVLDPGIVEHFDGRVTIEEKRNGYNVRVARIDGDVLGFTRSGYVCPYTTSKVRE
LLDPDSFFDANPERMLCGELIGPENPYTPHEYPDVESAAFEVFDVRDRETGRPLAVDHRR
DLCARHDLATVPAFGECDPVEAAEAVREVIADLDRAGKEGVVMQSMDGTRQLKYTTSATH
RADLEHAFSLPFDYGRDFVFPRVLREVFQAVELDRTRGESRQRAQELGESILLPAVETVR
AVERGETVGEEHTVRDDPAVIEALLSHLQEMGIKLEIQQDRDENGERVVSFVKVSQSTRD
NVENYLDGQVIDE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggatcgcgactgggcggcggttctcggcgtcaggagtgcggaagtcgattcg
gtcctcgcggcgttcgaggagagcgtcttcgaggggcggcgctaccgccacctctcggct
gcccgccacgggatcgagcgcggaacggcgatcgtcgacgggaccgtgatccgtgggttt
ccgtcgatcccgcggacgcttgtgctcgacccggggatcgtcgagcacttcgacgggcga
gtgacgatcgaggagaaacgcaacgggtacaacgtccgcgtcgcccggatcgacggcgac
gtcctggggttcacccggagcggatacgtctgtccgtacaccaccagcaaagtcagggag
ctactcgaccccgactcgtttttcgacgccaatcccgagcgcatgctctgtggcgagttg
atcggcccggagaacccctacacgccacacgagtatcccgacgtcgagtccgcggctttc
gaggtgttcgacgtccgcgatcgagagacgggccggccattggcggtcgatcaccggcgg
gacctctgtgcgcgccacgacctggcgacggttcccgcgttcggcgagtgcgatccggtg
gaggcggccgaggccgtccgggaggtgatcgccgacctggaccgggcaggcaaagaaggg
gtcgtgatgcagtcgatggacggtacccggcagctgaagtacacgacctcggcgacgcat
cgagccgatttggaacacgcgttctcgctccccttcgactacgggcgggacttcgtcttt
ccgcgggttctccgggaggtgttccaggccgtcgagctggatcgaacgaggggcgagtcc
cgccagcgagcccaggaactcggggagtcgatcctcttgcccgcggtcgaaaccgtcagg
gcggtcgagcgcggcgagactgtgggggaggaacacaccgtccgggacgaccctgccgtg
atcgaggcactcctctcgcacttgcaggaaatgggcatcaagctcgaaatccagcaggat
cgagacgagaacggcgagcgcgtcgtctcgttcgtgaaagtatcacagtcgacccgtgac
aacgtcgaaaactatctcgacggacaggtgatcgacgagtga

DBGET integrated database retrieval system