KEGG   Halorhabdus utahensis: Huta_1468Help
Entry
Huta_1468         CDS       T00971                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hut  Halorhabdus utahensis
Pathway
hut00620  Pyruvate metabolism
hut00680  Methane metabolism
hut00720  Carbon fixation pathways in prokaryotes
hut01100  Metabolic pathways
hut01120  Microbial metabolism in diverse environments
hut01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Huta_1468
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_1468
   00680 Methane metabolism
    Huta_1468
Enzymes [BR:hut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Huta_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Activator-TraM
Motif
Other DBs
NCBI-ProteinID: ACV11644
UniProt: C7NNW9
LinkDB All DBs
Position
1441610..1444306
Genome map
AA seq 898 aa AA seqDB search
MTLHGRELTQDVRELGELLGTIIEAQDSTDAYETVETIRNSAIAYRRGDGESREPIHDEL
DRLSPEMQDVVARAFTTYFELINLAEERERVREIREGVQSGDLSDTVEEAVETLDAEDVD
PDTVEEILEDVMIEPTFTAHPTEARRKTIKAKLWSVGKIIQDLDQIRLTDREKRRMKREL
QAEVTSLWQTPQVRDRRPDVTDETLNIQWYLENSLFDIISEVYDELEHALSETYDGEVDV
PKLYEFRSWAGSDRDGNPYVTPEVTEETLERQRSVALELYRDDLKSLSGVLSQDVENLEM
SDAFEESHEAHKQRLPGVADGIEERYPDEPYRQKLKLMRESVLRVDDVRSGAYDNDDELL
ADLEIIAESLRENDADEIVDAHVKPLIRKVDTFGFSLANLDLRDHREKHTNALVETLKRE
GIDYESMSEDERVEFLTEAILQDDPVIDIEDDEGLSEESAKVLTLFSDAAGWQREYGVDA
IDTYAISWFEESSHALEVLFLGDQAGIVDLPGYCGFDIVPLFESEYALTRVREMLGTLFE
NEAYSQALEARNNTQEILLGYSDSSKENGYLAANWELYRNQKRMANICDDFGVTLRLFHG
RGGSISRGGVPMHEAMLALPNQTVNGQIKFTEQGEAIAEKYGNPDIAERNLEQMLNAQVL
ARYNAMENPVEDIPEEWIEAFETAAEHASAEYRDLLETDGFVEYFEQATPITVIENLNMG
SRPASRTEDRSLEDLRSIPWVFSWTQARCIVPGWFSVATGIQGYLDEGGDMETLKEMYEE
WPYFGTILDHAGMALAKSDMEIATEYADLADDELRERFFPWIRSEYENSVELIQEISGRE
TLLNRSWMEENLQRRNPYVDPLNLLQTRLLAQSHLTETERRALRLTVHGIAAGMKNTG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgactttacacggcagagagctcacccaggacgtgcgcgagctgggggaactgctgggg
accatcatcgaggcacaggactcgacggatgcctacgagaccgtcgagacgatccggaac
agcgcgatcgcgtaccgtcgtggggacggcgagtcccgtgagccgatccacgacgaactc
gatcgactctccccggagatgcaggacgtcgtcgccagggcctttactacctacttcgaa
ctcatcaacctcgccgaggagcgcgaacgggtccgcgagatcagggaaggcgtccagagc
ggcgacctctcggacaccgtcgaggaagccgtcgagacgctcgatgccgaggacgtcgat
ccggacaccgtcgaggagattctcgaggacgtcatgatcgagccgacgttcacggcccat
ccgactgaagcgcgacgcaagacgatcaaagccaagctctggtcggtcgggaagatcatc
caggatctcgatcagatccggctcaccgatcgggagaagcgacggatgaagcgcgaactc
caggcagaagtgacgagcctctggcagacgccccaggttcgtgatcgccgccccgacgtg
accgacgagacgctgaacatccagtggtatctcgagaacagtctcttcgacatcatcagt
gaggtctacgacgaactcgaacacgccctgtcggagacctacgatggcgaggtcgacgtc
ccgaaactctacgagttccggtcgtgggccggcagtgaccgtgacggcaatccctacgtc
actcccgaagtcacggaggaaaccctcgagcgccagcgcagcgtcgcgctcgaactgtat
cgggacgatctcaagagcctctccggcgtgttgagccaggacgtcgagaacctggagatg
agcgacgcgttcgaggaaagccacgaggcacacaaacaacgcctcccgggcgttgccgac
ggaatagaggagcgatatcccgacgagccctatcgacagaagctgaagttgatgcgtgag
agtgtcctccgggttgatgacgtccgatccggtgcgtacgacaacgacgatgaactcctt
gccgatttggagatcatcgccgagagcctccgggagaacgacgcggacgagatcgttgat
gcgcacgtcaagccgctgatcaggaaggtcgacaccttcgggttctcgctggcgaacctc
gacctgcgggatcaccgcgagaaacacacgaacgcactggtcgagaccctcaaacgggag
gggatcgactacgagtcgatgtccgaggacgagcgcgtcgagttcctgacggaagcgatc
ctccaggacgacccggtcatcgacatcgaagacgacgaagggctctccgaggagtcagcc
aaggtcctgacgctgttctccgatgccgccgggtggcaacgggagtacggcgtcgacgcc
atcgacacctacgcgatcagctggttcgaggagtcctcacacgccctggaggtcctcttc
ctgggcgatcaagccgggatcgtcgatctccccggctactgcgggttcgacatcgtcccg
ctgttcgagagcgagtacgccctcacgcgcgtccgggagatgctggggacgctcttcgag
aacgaggcctacagccaggccctggaagcccggaacaacacccaggagatcctgctggga
tattcggactcctcgaaggagaacggctatctggccgccaactgggaactctaccgcaac
cagaagcggatggccaacatctgtgacgacttcggcgtcaccctccggctgttccacggg
cggggtggttcgatctcccggggcggcgtcccgatgcacgaggcgatgctcgccttgccg
aaccagaccgtcaacggccagatcaagttcaccgagcagggcgaggcgatcgccgagaag
tacggcaaccccgacatcgccgagcgcaacctcgaacagatgctcaacgcgcaggtcctg
gcgcggtacaacgccatggaaaaccccgtcgaggacatccccgaggagtggatcgaggcc
ttcgagacggcggccgagcacgccagcgcggagtaccgggacctcctggagaccgacggg
ttcgtcgagtacttcgagcaggcgaccccgatcacggtcatcgagaacctcaacatgggc
tcgcggccggcctcccggacggaggatcggagtctcgaagacctccggtcgatcccgtgg
gtgttctcctggacgcaggcccgctgtatcgtccccggctggttctccgtcgccacgggt
atccagggctacctggacgagggcggcgacatggagacgctcaaggagatgtacgaggag
tggccgtacttcgggacgatcctcgatcacgccgggatggcgctggccaaatccgacatg
gagatcgccaccgagtacgccgacctggccgacgacgagcttcgagagcggttcttcccc
tggatccggagcgagtacgagaactccgtcgaactcatccaggaaatctccgggcgcgaa
acgttgctcaaccgatcgtggatggaggaaaacctccagcgccggaatccgtacgtcgat
ccgctcaacctgctgcaaacccggttgctcgcccagtcacacctcacagagaccgaacgc
cgggcgctccggctgacggtccacggcatcgccgctggcatgaagaacacgggatga

DBGET integrated database retrieval system