KEGG   Halorhabdus utahensis: Huta_1471Help
Entry
Huta_1471         CDS       T00971                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hut  Halorhabdus utahensis
Pathway
hut00564  Glycerophospholipid metabolism
hut01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Huta_1471
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Huta_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 NAD_binding_8 DAO_C FAD_binding_3 3HCDH_N HI0933_like FAD_oxidored Pyr_redox_3 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ACV11647
UniProt: C7NNX2
LinkDB All DBs
Position
complement(1447043..1448800)
Genome map
AA seq 585 aa AA seqDB search
MTSSPSVLVIGGGSTGVGIARDAAMRGFDVTLVEKGNLTHGTTGRMHGLLHSGGRYAVSD
QASARECIDENMILRDIATHCVEDTGGLFVKRPEDTEEYYQEKLDGLRECSIPATELTAE
EARRKEPFLARDIDKAIEVPDAAIDPFRLCVANAISAANHGARIETFSEVTDLLVEDGEI
VGAEVTHESGEGNRVHGVEGSVEEIRVDHIVNAAGAWTGEIAAMADIDVEVRPSKGVMTI
MNVRQVDTVINRCQPKGDADIVVPHETTAILGTTDEEVGDPEDYPEEEWEVDLMIEELAK
LVPILDDARTIRSFWGVRPLYEPPDTGTDDPTDITREFFLLDHDERDALPGMTTIVGGKL
TTYRLMAEQLVDHLAEKFDVDTTCRTAEEPLPGSEDEGVIDDAMDDFGLRSPIAKRSAER
LGSRTQEVLDTNEPNPVVCGCEAVTRAEVNDAIEQSGTDLNAVRIRTRAGMGNCQGGFCS
HRLANELHPDFDEGRARAALDELYQERWKGQRHALWGRQLSQAMITYTMHALTMNRDRDP
AGGGSLDFGAFDSGPSNTPATDDGQPADGPPGVATDGGRGDGRGD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttccccctcggtgctcgtgatcggcggtggctcgacgggtgtcgggatcgcc
cgggatgctgcgatgcgtgggttcgacgtgacgctggtcgagaagggcaacctcacccac
gggacgaccggccggatgcacgggctgctccacagcggcggtcgctacgccgtctccgat
caggcgagcgcgcgtgagtgtatcgacgagaacatgatcctccgggacatcgccacccac
tgcgtcgaggacacgggcggactcttcgtcaagcgaccggaggacaccgaggagtactac
caggaaaaattggacgggctcagggagtgttcgatccccgcgacggaactcaccgccgaa
gaagcacgccggaaagagccgtttctcgcccgggacatcgacaaggcaatcgaggtgccc
gacgcggcgatcgaccccttccggctgtgcgtggccaacgccatcagtgctgcaaaccac
ggcgctcgcatcgagacgttctcggaagtgactgacttgctagtcgaggacggcgagatc
gtcggcgcggaggtcacccacgagagcggcgagggcaaccgcgtccatggggtcgagggg
tctgtcgaggagatccgcgtcgatcatatcgtcaacgccgcgggggcctggacgggcgag
attgcggcgatggccgacatcgacgtggaggtccggccctcgaagggagtgatgaccatc
atgaacgtccggcaggtcgacaccgtgatcaaccgctgccagcccaagggcgacgccgac
atcgtcgtgccccacgagacgaccgcgatcctcgggacgaccgacgaggaggtcggcgac
ccggaggactacccggaggaagagtgggaggtcgatctcatgatcgaggaactcgcaaag
ctcgtcccgattctcgacgacgcgcggacgatccgctcgttctggggtgtccgtccactc
tatgaaccacccgacaccgggaccgacgatccgacggacatcacgcgggagttcttcctg
ctcgatcacgacgagcgcgacgctctccccggcatgacgacgatcgtcggcgggaagctg
acgacctaccgactcatggccgagcaactcgtcgatcacctcgccgagaaatttgacgta
gacaccacctgccgcaccgccgaggaaccgcttcccggcagtgaagacgaaggcgtcatc
gacgacgccatggacgatttcggcctgcgctcgccgatcgccaaacggagcgccgagcgc
ctggggtcacgaacgcaggaggttctcgacaccaacgagcccaacccggtcgtctgtggg
tgtgaggccgtgacgcgtgcggaagtcaacgacgccatcgagcagtccggcactgacctc
aacgccgtccggatccgcacccgggccgggatgggcaactgccagggcggcttttgcagc
catcggctggcgaacgaactccaccccgatttcgacgaggggcgcgcacgggcggcgctc
gacgaactctaccaggagcgctggaagggccaacgccacgcgctctgggggagacagctc
tcccaggcgatgatcacctacacgatgcacgcgctgacgatgaaccgcgatcgcgatccc
gccggcggcggatcgcttgacttcggcgcgttcgattccgggccgtcgaacactcccgcg
accgacgacggacaaccggcggacgggccaccaggcgtcgccaccgacggtggcaggggg
gatggccgtggcgattga

DBGET integrated database retrieval system