KEGG   Halomonas venusta: EI420_06260Help
Entry
EI420_06260       CDS       T05892                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hvn  Halomonas venusta
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EI420_06260 (ahpF)
Enzymes [BR:hvn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EI420_06260 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO Glutaredoxin K_oxygenase Thi4 Methyltrn_RNA_4 FMO-like FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AZM95313
UniProt: A0A3Q8WCN6
LinkDB All DBs
Position
complement(1325204..1326760)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKNQLKAYLEKVTQPFEIVASLDDGAKSHELLGLLEEISGLCDKITLQTDGQDNR
TPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSEELLNQIKALDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPNIRHVAIDGALFQDEVEAREVMSVPSIYLNGKPF
DQGRMTLEQILAKVDTGAAEREAKKLGEKAAFDTLVIGGGPAGASAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVSHTEGPKLVSALEEHVKEYDVDVMNLQRATSFKAAENEGD
LHEIVFESGAKLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVDIILNAETTEVTGDG
SRVNGLAYKDRNTDELKTIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaaaatcagttgaaagcttatttagaaaaagtgactcaaccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacatgaactgttaggtttgctc
gaagagatcagcggcctatgcgacaagattacactgcaaactgacggacaagataatcgc
acgccgtcatttgcgattaaccgccccggcgaagaaaccggcgtggtatttgcgggcatc
ccgatggggcacgagttcacttcactggtgctggcactgttacaggtgggtggacatccc
ccaaaaacgtctgaagaactgctcaaccaaatcaaggcgctcgatggcgaaatgctgttt
gagacgtactattctctctcctgccagaactgcccagatgttgttcaagcgcttaacttg
atggcgattttcaatccaaatattcgccatgtggccattgatggcgcactgtttcaggat
gaagtcgaagctcgggaagtcatgtcggttcccagcatctatttaaatggtaaaccgttt
gatcaagggcgcatgactttagagcagattctagccaaggttgatacgggcgccgccgaa
cgggaagcaaaaaaacttggcgaaaaagccgcctttgatacgctggtgattggtggcggc
cctgcaggagcctcagccgcaatctactctgcccgtaaagggatcaacacaggtgttgct
gctgagcgtttcggtggccaggtggcggacaccatgggcattgaaaactttatctctgtc
agccataccgaaggccctaaactggtaagcgctctggaagagcatgttaaagagtatgac
gttgacgttatgaaccttcaacgcgccacatcgtttaaggccgctgaaaacgaaggtgat
ttacacgaaatcgtcttcgagtcgggcgccaagctgaagagtaaaacgcttgtcctggca
accggtgcgcggtggcgcgagatgaatgtgcctggcgaacaacagtaccgcaacaaaggc
gttgcttactgccctcactgcgatggcccgctatttaaaggcaagcgcgtagcagtgatt
ggcggaggtaactctggtgttgaggccgctatcgacctggcgggcattgtaggccacgtc
accttagtcgaatttatgggtgagatgcgtgcagacgccgtgctacagaaaaagcttaag
agcctgcctaacgtcgacattattttaaacgctgaaaccacggaagtaaccggcgacggc
agtcgtgttaatggtttagcctacaaagaccgcaataccgatgagctaaaaaccatcgca
ttagaaggtatctttgtccaaattggcttagtgcctaataccgagtggctgaaaggctca
ccgattgaaatgactccgcgcggcgaaatcattgtcgacgcccacggcatgacatcggtt
ccaggcgtatttgccgcaggtgacgtgacaaccgtgccatacaagcaaattattatcgct
atgggtgagggtgcaaaagcatcactgggtgcgttcgactatttgattcgtcactaa

DBGET integrated database retrieval system