KEGG   Halomonas venusta: EI420_11215Help
Entry
EI420_11215       CDS       T05892                                 

Definition
(GenBank) DMT family transporter
Organism
hvn  Halomonas venusta
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA EmrE CcmD
Motif
Other DBs
NCBI-ProteinID: AZM96213
UniProt: A0A3S8YTE8
LinkDB All DBs
Position
complement(2354054..2354959)
Genome map
AA seq 301 aa AA seqDB search
MNSLLYISTVLIWGSTWLAIAWQVGKVAVPVSVFYRFLIAALVLLIGLTLLRRRQALQTR
DHLFCLLQGGCVFGLNFYCFYTAAGYLPSGLIAILFSMSILFNAANGYLFFRTPVPRVFY
LALALGLPGMALIFWQDLVTVEATWELLGAIGLTLLGTYGFSLGNMVSVRHQRCGLQINT
TNAFAMLYGGMLMGLIAWAQGASFSLPAEPRYLGALVYLAVIGSVGGFGAYFMLVGRIGA
GKAAYATVLFPLVALALSTVFEGYQWHANALIGLVMIVSGNLLMFNAHRLVWRWWEAPSH
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccttctgtatatctcaacagttcttatctggggttcgacctggctggctatc
gcttggcaagtgggcaaggtggcggtgccggtctcggtattctatcgttttctcatcgcc
gcgctggtgctgttgatcgggcttacattgttgcgccgacgccaggctctgcaaaccagg
gatcatcttttctgcctgttgcaggggggctgtgtctttggtttgaatttctactgcttc
tataccgctgcgggttatctgcccagcggcctaattgccatcctgttttctatgtcgata
ctgtttaatgcggccaatggctacctgttctttcgcacaccggttccgcgggtattttac
ctggctttggcccttggtctgccgggcatggcgctgattttctggcaggatctggtcaca
gttgaggctacgtgggaactgctgggcgccattggcttgacgttgctgggcacctacggg
ttttcgctgggtaacatggtgtcggtcaggcaccagcgatgcggtctgcaaatcaacacc
accaacgcctttgccatgctgtatggagggatgttgatggggttgattgcctgggctcag
ggagccagtttcagcctaccagcggaaccgagatatctaggtgccctggtttatttggcg
gtaataggatcggtgggaggctttggtgcctactttatgctggtcggccgtattggtgcc
ggtaaggcggcttatgcgacggtattatttcctttggttgcgctggcgctgtcaacggtg
ttcgagggttaccagtggcatgcgaatgcacttatagggttagtaatgattgtgagtggc
aacctgctgatgtttaatgcccatcgtttggtttggcggtggtgggaggcgccgagccat
atatga

DBGET integrated database retrieval system