KEGG   Halomonas venusta: EI420_11985Help
Entry
EI420_11985       CDS       T05892                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hvn  Halomonas venusta
Pathway
hvn00550  Peptidoglycan biosynthesis
hvn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EI420_11985
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EI420_11985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hvn01011]
    EI420_11985
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hvn03036]
    EI420_11985
Enzymes [BR:hvn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EI420_11985
Peptidoglycan biosynthesis and degradation proteins [BR:hvn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EI420_11985
Chromosome and associated proteins [BR:hvn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EI420_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PepSY
Motif
Other DBs
NCBI-ProteinID: AZM96357
UniProt: A0A3Q8WGR6
LinkDB All DBs
Position
complement(2513924..2515630)
Genome map
AA seq 568 aa AA seqDB search
MKRESRGGISRQMPIAPPLAGGRFLFILIVVMVASVILVGRITLLQVIDRPFLQSQGDAR
TLRHEAIPAHRGMITDRNGEPLAISTPVVTLWANPQELPTDAIQRVMLAQALGMSLDDFE
SRVSRYSSREFMYLRRQMTPDAAQRILDLRTPGVYQQREYKRYYPAGEVAAQLLGVTNVD
DVGQEGLELSYQPYLAGHPGQRRVIKDRRGRLVRELGVIREAQPGGELTLSIDQRIQYMA
YRELRAAVAEHEADGGVLVMLDARTGEVLAMANLPSYNPNNRAGLDPRGLRNQALVDVFE
PGSVMKPLAMAAILESGVVDRDAVVDTSPGWMRLDQFTIRDFRNYGDLDLAGILQKSSNV
GMSRLALQLSDTAIWEKYNQLGLGQAPGTGFPGEAAGSLPAPVRWSRSERATLSYGYGLS
VSAVQLASAFTALANEGVRLPPSLLRLSEPPQGIPAISPTVANDLLNILETSVAAYTGGR
RAQVEGYRVGGKTGTVRKIGQQGYTTDAYRSVFAGIAPISDPRIVTVVMIDHPRAGQFYG
GAVAAPVFSSVTGNALRLLDVPPDHEVE
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgaaagtcggggagggatatcccgtcaaatgcctattgcgccgccattagct
ggcggacgctttttgtttattctcattgttgtaatggtggcgtcggttattctagtcggc
aggattacgctgcttcaggtaattgatcgcccgtttttgcagagccaaggcgatgcacgg
acgcttcgccatgaggcaatacccgcacaccgcggtatgatcactgatcgtaatggtgaa
cctctggctatttctacgcctgttgtgacgctttgggcaaacccccaagagctacctacc
gatgctattcagcgtgtaatgctggcccaagctttgggcatgtcgctcgatgactttgaa
tcgcgtgtttctcgctatagcagtcgagagtttatgtatcttcgccgtcaaatgacgcca
gatgcggcccaacgcatactggatttacgtacgccgggggtttatcagcagcgtgaatac
aaacgttattatcccgctggcgaagtggcggcgcagctgctgggtgttaccaatgtggat
gatgtgggccaagaggggcttgaactctcttatcaaccctatttggcggggcaccctggg
cagcgccgagtcataaaagatcgacgaggtcggctagtccgtgagctgggtgttattcgt
gaagcgcaaccgggtggtgagttaacgctgtcaattgatcagcgcattcaatatatggcc
taccgtgagttgcgtgctgctgtcgccgagcatgaggcggacggtggggtgttggtaatg
ctcgatgcgcgcacaggggaagtgttagcaatggctaacttgccatcttacaacccaaat
aaccgcgctggtttggacccgcgaggtttacgcaatcaggcgctggttgatgtatttgaa
cctgggtctgttatgaagcctttggcaatggctgcgatactggaaagtggtgttgtagat
cgcgatgctgtcgttgatacctcgcccggctggatgcgcctggatcagtttactatccgc
gacttccgtaattacggcgatttagatttggcggggattctacaaaagtcttcaaacgtt
ggtatgtctcgtttagcgctgcagctaagcgatacggcaatttgggaaaaatacaatcag
ctaggccttgggcaagcaccaggtactggctttcctggtgaggcggcaggtagcttgccg
gcaccggttcgctggtctcgaagtgagcgagcgacgctctcctatggctacggtctctct
gtttcggccgttcaattggccagtgctttcacagcgctagccaatgaaggcgtacgcttg
ccgccctcgctgttgaggctttctgagcctcctcaagggattcctgctatatcgcccaca
gtggctaatgatttgctgaatattttggaaacgtcggtcgccgcctataccggtgggcgc
cgagcgcaggttgaaggctatcgtgtggggggaaaaacaggcacggtgcgtaaaataggg
cagcaaggctataccactgatgcttaccgcagtgtttttgcggggattgcacctatttcc
gatccgcgtattgttaccgtcgttatgattgaccacccccgcgctggtcaattttatggt
ggcgcagtggctgctccggtgttttctagcgtgacaggtaatgccctacgtttgctggac
gtgccgcccgatcatgaggtcgagtag

DBGET integrated database retrieval system