KEGG   Halomonas venusta: EI420_16695
Entry
EI420_16695       CDS       T05892                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
hvn  Halomonas venusta
Pathway
hvn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EI420_16695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hvn01001]
    EI420_16695
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hvn02022]
    EI420_16695
Enzymes [BR:hvn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EI420_16695
Protein kinases [BR:hvn01001]
 Histidine kinases
  OmpR family
   EI420_16695
Two-component system [BR:hvn02022]
 OmpR family
  RstB-RstA
   EI420_16695
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 HisKA_3
Other DBs
NCBI-ProteinID: AZM97197
UniProt: A0A3S8YVZ4
LinkDB
Position
complement(3602100..3603695)
AA seq 531 aa
MRRVLGHGSFLRFYLLLGLALCVVFFIALGGRSFIEQIRREDYREQLAALPMSLMTQQLA
SSPVAGRESLLARFSEQLGMQLSLKRIESVGLNYFEQARVERGTVLVAEDPWRLRQRIPN
DEWLLEATFAAWSERQWQGSMILLGGWLASMPHEARADAIASLDAGSWPLVLLSAPPSDL
TPEQQFQLAQGGVLTRLVSDKLSLMLLYRLPDDNQWLQAGPTSRGDTLPANLHLPLLVGL
MVVLSLIIYLIMRSIEARMARLELAATRIASGRLETRVKVESGDFLGRLGMAFNGMANQV
QSLLRGQQEMIRAVSHELRTPVARIRFAVQMVEDMTDQPAIRRQLQGIDADISELDELVD
EILTYARLGGESINGVELEMALVECRAMAERVIDTLSPLHQSLSLTLDGSAEVELYAEPR
YLQRALQNLVSNACRYGKSQVVIRLWDEPHLVRIDIEDDGPGIPPEARSDIFKPFARLDD
SRARSSGGYGLGLSIVQKIMAGHGGSVTVDTSPTLGGARFTLLIPRRELPV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcggcgagtgctgggccacggttctttcttaaggttttatcttctgctggggcttgca
ctgtgcgtagtattctttattgcattgggcgggcgctcttttattgagcagattcgtcgc
gaagattatcgtgaacagcttgccgcattgccgatgtcattaatgacgcagcagttagca
tcaagtccggtggcgggaagagaaagcctgcttgcccgcttctcggaacagctggggatg
cagctctcacttaagcgtattgagagtgtagggcttaactattttgagcaagctcgcgtc
gagcgaggcacggtattagttgctgaagatccttggcggttacggcaacgtatacctaac
gatgagtggctgctggaggcaacatttgccgcctggagcgagcgtcagtggcagggcagc
atgatactactcggggggtggcttgctagtatgcctcatgaggcgagggctgacgccatc
gcctcgctagacgcaggtagttggccacttgttttgctttccgcgccgccttctgacctt
actccagaacagcagtttcaactcgcccagggaggcgtgttgactcggctggtgtcggat
aagctctcactgatgctgctttatcggctgccggatgataatcaatggttacaagcgggg
ccgacctcgcgtggtgatacgctgccagccaatttgcatctgcctttactggtggggtta
atggtggtgctgagcctaattatttatttaattatgcgcagcattgaagcgcgtatggcg
cgtttggagcttgccgcgactagaatcgccagcgggcgcttagaaacccgggtaaaggtg
gaaagcggagactttttaggccgtctgggcatggcattcaatgggatggcgaatcaagtt
cagagtttgctaagaggtcagcaagaaatgattcgcgcggtctctcatgaattacgcacg
ccggtggctcgtatacggtttgcagtgcaaatggtcgaagatatgaccgaccaaccagcg
attcgtcgtcagcttcaggggatcgatgctgatatttccgagctagacgaattggtagac
gaaattctcacctatgcccgcttggggggagagtcgatcaatggcgttgaattagagatg
gcattggttgagtgccgggcaatggctgagcgagtcatcgacacgctgtcaccgttgcac
caaagcttatcgttaacgctggatggtagtgctgaagttgagctgtacgccgaaccccgc
tatttacaacgagcgctgcagaaccttgtcagcaacgcttgtcgctatggcaagtcgcaa
gtagtgattcgcctatgggatgagcctcaccttgtacggattgatattgaggatgatggg
cctggcataccacccgaggcgcgtagcgatatcttcaagccgtttgccaggcttgatgac
agtcgtgcccgtagctctgggggctacgggcttggcttatccatagtgcaaaaaattatg
gcaggccatggcggtagcgtcactgtggataccagccctacactgggcggtgcgcgcttt
acgctgctgattcctcgtcgcgagttgccggtttaa

DBGET integrated database retrieval system