KEGG   Haloferax volcanii: HVO_0444Help
Entry
HVO_0444          CDS       T01200                                 

Gene name
udg3
Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
hvo  Haloferax volcanii
Pathway
hvo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    HVO_0444 (udg3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hvo03400]
    HVO_0444 (udg3)
Enzymes [BR:hvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     HVO_0444 (udg3)
DNA repair and recombination proteins [BR:hvo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HVO_0444 (udg3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADE04913
UniProt: D4GRY5
LinkDB All DBs
Position
393985..394581
Genome map
AA seq 198 aa AA seqDB search
MEHMEGLCVTGCERCPELVDSRSRIVNGVGPDDADLLFLGEAPGAKEDEGGEPFVGRSGS
VLDDALREAGLARADVRITNCVRCRPPDNRDPTSDELSNCRGYLARELELVDPELVVTLG
KVPSQHLLDRGVAITNESGSVVDARVGDASYRVLLSVHPAATLYDRSQREGFFETIARAA
DLSGLADSADGQASLGDF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatggagggcctctgcgtgacgggctgtgagcgatgccccgaactcgtcgac
tcgcggagtcgcatcgtcaacggggtcggccccgacgacgccgacctgctcttcctcggt
gaagcgccgggcgcgaaggaagacgagggcggcgagccgttcgtgggtcgctccggctcc
gtgttggacgacgcgctccgcgaggccggcctcgcccgcgccgacgttcgcatcaccaac
tgcgtgcggtgccgcccgccggacaaccgcgacccgacgagcgacgaactgtcgaactgc
cggggctacctcgcccgcgaactcgaactcgtcgaccccgaactcgtcgtcacgctcgga
aaggtgccctcccagcacctgctcgaccgcggtgtcgccatcacgaacgagtccgggtcg
gtcgtggacgcccgagtcggggacgcctcttaccgcgtcctcctctccgtccaccccgcg
gcgacgctgtacgaccggagccaacgcgagggcttcttcgagaccatcgcgcgcgccgcc
gacctctcggggctcgcggactccgcggacggacaggccagtctcggtgacttctga

DBGET integrated database retrieval system