KEGG   Haloferax volcanii: HVO_0970Help
Entry
HVO_0970          CDS       T01200                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hvo  Haloferax volcanii
Pathway
hvo00630  Glyoxylate and dicarboxylate metabolism
hvo01100  Metabolic pathways
hvo01120  Microbial metabolism in diverse environments
hvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HVO_0970 (rbcL)
Enzymes [BR:hvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HVO_0970 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADE04153
UniProt: D4GV77
LinkDB All DBs
Position
complement(879448..880692)
Genome map
AA seq 414 aa AA seqDB search
MGITYEDFLDLDYEPTDEDLVCTFRIDPATGMSTEAAASRVASESSNGTWAALQTGADFT
DMGATTFDIDGDLIRVAYPAGLFEPGNMPQVLSCIAGNIMGMKAVDTIRLLDCEWPESVV
SAYPGPLYGSSVREEIFGVTDRPITATVPKPKVGLSTAAHAQVGYDAWVGGVDLLKDDEN
LTDQAFNPFSDRLTESLSLRDDAEDETGEKKSYLINVTADTQTMLDRVDEVAAQGGEYVM
VDIITAGWAGLQTVRERTEKHGLAIHAHRAMHAAFDRLPAHGVSMRVLAQVSRLCGVDQL
HTGTAGLGKLANEDTVGINEWLAGDLHGATDVLPVASGGLHPGLLPDLLDATGTNVCVQL
GGGIHGHPDGTRAGAVALRSAIDAYVEGRAITEAAEETPELAVALDKWGTETPR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcacgtacgaagacttcctcgacctcgactacgaaccgaccgacgaggacctc
gtctgcaccttccgtatcgaccccgcgacggggatgtcgacggaggcggcggcgagtcgc
gtggcctcggagtcctccaacgggacgtgggcggccctccagaccggcgcggacttcacc
gacatgggcgcgacgacgttcgacatcgacggcgacctgattcgggtcgcctaccccgcc
gggctgttcgaacccggtaacatgccgcaggtgctgtcgtgcatcgccggcaacatcatg
gggatgaaggcggtcgacacgattcgcctcctcgactgcgagtggcccgagtcggtcgtc
tcggcgtaccccggcccgctgtacgggtcgtcggtccgcgaggagatattcggcgtcacc
gaccgccccatcacggcgacggtgcccaagccgaaagtcggcctctcgacggccgcacac
gcacaggtcggctacgacgcgtgggtcggcggcgtcgacctcctgaaggacgacgagaac
ctgaccgaccaggcgttcaaccccttctccgaccgcctcacggagtcgctgtcgctccgc
gacgacgccgaggacgagacgggcgagaagaagtcctacctcatcaacgtcaccgccgac
acccagacgatgctcgaccgggtcgacgaggtggccgcgcagggcggcgagtacgtcatg
gtggacatcatcaccgcgggctgggcgggcctccagaccgtccgcgagcgcaccgagaaa
cacggcctcgccatccacgcccaccgcgccatgcacgccgccttcgaccggcttccggcc
cacggcgtctcgatgcgggtgctcgcgcaggtgagtcgtctctgcggcgtcgaccagctc
cacaccggcaccgccggcctcggcaaactcgccaacgaggacaccgtcggcatcaacgag
tggctcgcgggcgacctccacggcgcgaccgacgtgctcccggtcgcctcgggcggcctc
caccccggtctgctccccgacctgctcgacgccacggggacgaacgtctgtgtccagctc
ggcggcggcatccacggtcatcccgacggaacccgcgcgggcgcggtcgcgctccggtcg
gccatcgacgcctacgtcgaggggcgcgctatcaccgaggccgccgaagagacgcccgag
ctcgccgtcgccctcgataagtgggggacggagacgccgcggtag

DBGET integrated database retrieval system