KEGG   Haloferax volcanii: HVO_2621Help
Entry
HVO_2621          CDS       T01200                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hvo  Haloferax volcanii
Pathway
hvo00620  Pyruvate metabolism
hvo00680  Methane metabolism
hvo00720  Carbon fixation pathways in prokaryotes
hvo01100  Metabolic pathways
hvo01120  Microbial metabolism in diverse environments
hvo01200  Carbon metabolism
Module
hvo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HVO_2621 (ppc)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HVO_2621 (ppc)
   00680 Methane metabolism
    HVO_2621 (ppc)
Enzymes [BR:hvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HVO_2621 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Ca_chan_IQ EGL-1
Motif
Other DBs
NCBI-ProteinID: ADE03262
UniProt: D4GUG0
LinkDB All DBs
Position
2469881..2472574
Genome map
AA seq 897 aa AA seqDB search
MRLHTRDVRQDVRELGALLGDVLEAQTSTASFETVEELRQAAISYRKGESGSRERLYDVV
GDLEPERESVVARAFTTYFELINLAEERERVRVIREASQEGTLEDGILDTLDALDDEEVD
EELLGRVLEDVLIEPTFTAHPTEARRKTVKSKLRSIANRLETLDERRLTDLEHDQEWRHV
VAEVTSLWQTSQVRDRRPEPTDEARNVQWYLENTLFDVVGEVYEELEEELRAEYPGLDVP
KLFEFRSWAGSDRDGNPFVTPEVTEDTLERQRSVALEKYSDSLKRLSGVLSQDATRIDPG
HELERSLKADREHLPVVAEEADERYPNEPYRQKLKLMRERLRRAEDVRPNGYADASELMA
DLEVVDASLRRTGAEQVADVYVEPLMRQVDTFGFTLASLDLRDHQENHTEAVHEALAHEG
LDYYGSSEQERVELLTDAILQEEPVVDLEDPGDVSETAERVLRRFRKLGEWQREYGVGAI
DTYCISMTEEPSHVLEVLFLADQAGVVSLPDHCGIDVVPLLETESALNGARRIMGTLFEN
EAYGTALAARNDVQEIMLGYSDSNKENGFLAANWDLYKNQRRLADICDDFDVTMRLFHGR
GGSISRGGGPMNEAMLALPNETVTGQIKFTEQGEAIAEKYANPRIAERNLEQMLNAQIRA
RLQAIRTPEEEVPDRWVDAMDTMAAAARAEYRDLLESDGFVSYFEQATPITVIEELNLGS
RPASRSDERSVEDLRAIPWVFSWTQSRCILPGWYSLAAGVNAFLEDGGDMDDLREMYDEW
AFFRSTFDNAAMALARTDLEIATEYANLADEELREEFFTRLTEEYEDAADLMLDISERSS
LLKREWLEESLRRRNPYVDPLNLLQTHLLSQTHRTDEEERTLRLTVKGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgcacaccagagacgtgcggcaagacgttcgcgagctgggggcactgctcggt
gacgtgctcgaagcgcagacgtcgacggcgtcgttcgagacggtcgaagagcttcgacag
gcggccatctcctaccggaagggcgagtccgggtcgcgcgagcggctctacgacgtggtc
ggcgacctcgaaccggagcgcgagagcgtcgtcgcccgcgcgttcacgacctacttcgaa
ctcatcaacctcgccgaggagcgcgagcgcgttcgcgtcatccgcgaggcgtcccaggag
gggacgctcgaagacggcatcctcgacacgctcgacgcgctggacgacgaggaggtcgac
gaggagcttctgggacgggtcctcgaagacgtgctcatcgagccgacgttcacggcccac
ccgaccgaggcccgccggaagacggtgaaatcgaagctccgctccatcgccaaccggctg
gagacgctcgacgagcgccgtctcaccgacctcgaacacgaccaggagtggcggcacgtc
gtcgccgaggtgacgagcctctggcaaacctcgcaggtccgcgaccgccgcccggagccg
accgacgaggcccgaaacgtccagtggtacctcgaaaacacgctgttcgacgtggtcggc
gaggtgtacgaggaactcgaagaggagctccgcgccgagtaccccggcctcgacgtgccg
aagctgttcgagttccggtcgtgggccggctccgaccgcgacggcaaccccttcgtcacg
cccgaggtgaccgaagacacgctcgaacgccagcgaagcgtcgccctggaaaagtacagc
gactcgctcaaacgtctctccggtgtgctgagtcaggacgcgacgcgaatcgaccccggc
cacgagctcgaacgctcgctgaaggccgaccgcgaacacctccccgtcgtcgccgaggag
gccgacgagcgctaccccaacgagccgtaccgccagaagctcaagctgatgcgcgagcgg
ctccgccgcgccgaggacgtccgcccgaacggctacgccgacgcgagcgaactcatggcc
gatctcgaggtcgtcgacgccagcctccggcggaccggcgcggagcaggtcgcggacgtg
tacgtcgagcccctgatgcgacaggtcgacacgttcggcttcaccctcgccagcctcgac
ctccgcgaccaccaggagaaccacaccgaggccgtccacgaggcgctggcccacgagggt
ctcgactactacggcagttccgaacaggagcgcgtcgaactcctcacggacgcgattctc
caggaggagccggtcgtcgacctcgaagaccccggcgacgtgtccgagacggccgagcgc
gtcctccgccggttccgcaagctcggcgagtggcagcgcgagtacggcgtcggcgctatc
gacacctactgcatctcgatgaccgaagagccgtcgcacgtcctcgaagtgctgttcctc
gccgaccaagcgggcgtggtctccctgcccgaccactgcggcatcgacgtggtcccgctc
ctcgaaaccgagtcggcgctcaacggcgcgcgccgaatcatgggcacgctgttcgagaac
gaggcctacgggacggcgctcgccgcccgcaacgacgtccaggagatcatgctgggctac
tccgactccaacaaggaaaacggcttcctcgcggccaactgggacctctacaagaaccag
cgccgcctcgcggacatctgcgacgacttcgacgtgacgatgcggctgttccacggccgc
ggcggctccatctcccgcggcggcggcccgatgaacgaggccatgctcgcgctcccgaac
gagaccgtcacggggcagattaagttcaccgaacagggcgaggccatcgccgagaagtac
gccaacccgcgcatcgcggagcggaacctcgaacagatgctcaacgcccagattcgcgcc
cgcctgcaagcgattcggacgcccgaggaggaagtccccgaccgctgggtcgacgccatg
gacaccatggcggccgccgcgcgcgcggagtaccgcgacctcctcgaatccgacggcttc
gtctcctacttcgagcaggcgacgcccatcaccgtcatcgaggaactcaacctcggctcc
cggccggcctcccggtccgacgaacggagcgtcgaggacctgcgggccatcccgtgggtg
ttctcgtggacccagtcgcggtgtatcctccccggctggtactcgctggccgccggcgtc
aacgccttcctcgaagacggcggtgatatggacgacctccgcgagatgtacgacgagtgg
gcgttcttccgcagcacgttcgacaacgccgcgatggcgctggcgcgcaccgacctcgaa
atcgccacggagtacgcgaacctcgccgacgaggagctccgcgaggagttcttcacccgg
ctcaccgaggaatacgaggacgccgcggacctcatgctcgacatcagcgagcgcagcagc
ctcctgaagcgcgagtggctcgaagagagcctccgccgccgcaacccctacgtcgacccg
ctgaacctgttgcagacccacctgctgtcgcagacccaccggaccgacgaggaagaacgg
accctgcggctcaccgtcaaaggcatcgccgccgggatgaagaacacgggataa

DBGET integrated database retrieval system