KEGG   Haloferax volcanii: HVO_2595
Entry
HVO_2595          CDS       T01200                                 

Gene name
oadhA2
Definition
(GenBank) 2-oxoacid dehydrogenase E1 component alpha subunit
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
hvo  Haloferax volcanii
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HVO_2595 (oadhA2)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     HVO_2595 (oadhA2)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Other DBs
NCBI-ProteinID: ADE05120
UniProt: D4GUA9
LinkDB
Position
2444152..2445213
AA seq 353 aa
MVSVTDLQTMYEQMVTARHYEERLVDEYLVGKQPAFDISAGPIPGELHLAAGHEASGAGV
CMHLRDDDTVTAPHRPHHIAIAKGVDLKRMTAEIFGRKTGLCRGKGGHMHLFDPDVNFAC
AGIIAQGCPPAVGAAMAAKKRNTDSVAVAFLGEGAIDQGGFLESLNLAAVHDLPVVFVVE
DNDWAISMPKDRVTDVQNGAQRAAGFDLPGVRIDSDDATAVYEAAGEAVMRARDGNGPTL
IEVQVHRRMGHFMGDAEAYRPEADIDRAKQRDSIERLAADLRSHGVTDDDIDEMRERAHG
RVEAAISWAKEQPEPEPAEAYENVFTNPPAQAATDGGSAADAPGDAGETGGDN
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggtgagtgttaccgacctacagacgatgtacgagcagatggtgaccgctcggcactac
gaggagcgactagtggacgagtacctcgtcggcaaacagccggcgttcgacatctcggcg
gggccgattcccggcgaactgcacctcgcggccggccacgaggcgtccggggcgggcgtc
tgcatgcacctccgcgacgacgacacggtgaccgcgccgcaccgaccgcaccacatcgcc
atcgcgaagggcgtcgacctcaagcgcatgacggccgagattttcggccggaagacgggg
ctgtgccgcgggaagggcggccacatgcacctgttcgaccccgacgtgaacttcgcgtgt
gcgggcatcatcgcgcagggctgtccgccggcggtcggcgcggcgatggccgcgaaaaag
cggaacaccgactcggtcgccgtcgccttcctcggcgagggcgctatcgaccagggcggc
ttcctcgaatcgctgaacctcgcggcggtccacgacctcccggtcgtcttcgtcgtcgag
gacaacgactgggccatcagcatgccgaaagaccgcgtgaccgacgtgcagaacggcgca
cagcgcgccgccggcttcgacctgccgggcgtccgcatcgactccgacgacgccacggcg
gtctacgaggccgcgggcgaggccgtgatgcgcgcccgcgacggcaacgggccgacgctc
atcgaggtgcaggtccaccgccggatgggtcacttcatgggcgacgccgaggcgtaccgc
ccggaggccgacatcgaccgcgcgaaacagcgcgactccatcgagcgactcgccgcggac
ctccgctcgcacggcgtgaccgacgacgacatcgacgagatgcgggagcgcgcccacggg
cgggtcgaggcggcgatttcgtgggcgaaagaacagcccgaacccgagccggcggaggcg
tacgagaacgtgttcacgaacccgccggcgcaggcggcgaccgacggcgggagcgcggca
gacgcgccgggcgacgccggcgagacgggaggcgacaactga

DBGET integrated database retrieval system