KEGG   Haloquadratum walsbyi DSM 16790: HQ_1795AHelp
Entry
HQ_1795A          CDS       T00375                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
hwa00240  Pyrimidine metabolism
hwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HQ_1795A (tdk)
Enzymes [BR:hwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HQ_1795A (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Helicase_RecD
Motif
Other DBs
NCBI-ProteinID: CAJ51923
UniProt: Q18J88
LinkDB All DBs
Position
975402..976079
Genome map
AA seq 225 aa AA seqDB search
MRAITNSGWIEVVTGSMFSGKTEELLRRLRRAEIAGQSIAVFKPAVDDRYGETTVGSHVG
RQWEAAVVPNEGEDIWNIKHELSKKKQNHRTTTQCRSGDGTNNPGGVIPSNDDSVDVVAI
DEANFFSTELVSVCESLANDGYRVVVSGTDQTYRGEPFEPLPQLMAVAEYVDKLQAICTQ
CGEPATRNQRLVDDSPAHIDDPTIVVGADETYEARCRNCHILRHE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcaatcactaatagcggctggattgaggttgtcacggggtcaatgttctcaggt
aagactgaggaactcctccgtcgattgcgacgagccgagattgctggtcaatctattgct
gtattcaagcctgctgttgatgaccgatatggagagacaactgttgggtcacatgtcggt
cgacaatgggaagcagcggttgttccgaatgaaggagaagatatctggaatatcaaacac
gaactttcgaagaaaaagcagaatcaccggacaaccactcaatgcaggagtggtgacggg
acaaacaacccaggtggagtaattccatctaatgatgactcagtcgatgttgtcgccatt
gatgaagcaaatttcttctcaactgaacttgtgtctgtttgtgaatcgctagcgaatgat
ggctatcgggtcgttgtgtctggcactgatcaaacatatcgcggcgagccatttgaacca
cttccacaattaatggcggtcgcagaatatgttgataaattacaggcaatctgtacacaa
tgtggtgaacctgcaacgcggaatcagcgacttgttgatgattcccccgcacatatcgat
gatccgacaatcgtcgtcggtgctgatgagacctatgaggcacgatgtcgtaactgtcat
attctccggcatgagtaa

DBGET integrated database retrieval system