KEGG   Haloquadratum walsbyi C23: Hqrw_3006Help
Entry
Hqrw_3006         CDS       T01942                                 

Gene name
glpA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00564  Glycerophospholipid metabolism
hwc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hqrw_3006 (glpA2)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hqrw_3006 (glpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox 3HCDH_N FAD_oxidored FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: CCC40802
UniProt: G0LLJ6
LinkDB All DBs
Position
2034475..2035728
Genome map
AA seq 417 aa AA seqDB search
MTIQTDVAIIGGGATGAGIARDLALRGVDVSLFERGGLGGGTSGRSHGLLHSGGRYAESD
PIGAEECIRESRILRDIAEGCIRETGGLFVQLESDDPAYFEEKLEACNELDIPTETISAE
EAHERVPGLTEDVERAFTVPDGVIYPSRLVVANAADAREHGASIHTHTPVESVTTANGEI
TELHVGGEINDTVEATQIVNATGAWAEVMGEDLGVDVSMQPTRGVMISVEYDGLDPVLNR
CRDPDDGDIIVPHDGEVVLGTTSVAVEDPDDYEEADWEVERSVDECAELIPDITDAPEVR
TWWGVRPLYEPDEDERDDGRGISRGFFVINHAERNEPANLISVVGGKLTTYRQMAEAASD
QICARLGVDASCETDERPLHASDDPAQLDALIDEFDAVNPTDRDIVTTATPAESAAD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccaaacagatgttgcaataatcggcggcggagcgactggtgctggaattgct
cgtgatctcgcacttcgtggcgttgatgtatcactctttgagcgtggcggacttggcgga
ggcacctccgggcgctcgcatggattattacatagtggtggtcgatacgcagagtctgac
ccaattggtgctgaggaatgcatccgcgaaagtcgaattcttagggatatcgctgaggga
tgtatccgtgagactggaggattattcgttcaacttgagtcagatgatcctgcatacttc
gaggaaaaactcgaagcctgtaatgaacttgatattccgactgaaacaattagtgctgag
gaggcacacgaacgcgttcccgggctaactgaggatgttgaacgggcatttaccgtccct
gatggggtgatctacccatcacgacttgttgttgccaatgctgcagacgctcgtgaacac
ggtgcatcaattcatacacatacccctgttgagtcggtcacgactgctaatggagagata
acagaattacacgtcggaggtgagattaacgataccgttgaagcaacacaaattgtcaac
gctaccggtgcatgggcagaggtaatgggtgaggatcttggtgtcgatgtctcaatgcaa
ccaacgcgtggagtgatgatctcagttgaatatgatgggcttgacccagttttgaatcga
tgtcgtgaccctgatgatggtgatattatcgtcccacacgatggtgaagtcgtacttggg
acaacaagcgttgcagttgaagatccagatgattatgaggaagctgactgggaggtcgag
cgatctgttgatgaatgtgcggaattgatcccggatattacagacgctccagaagtccga
acctggtggggtgttcgaccattatatgagcctgatgaagatgagcgcgatgatggtcgt
ggtatctcacgtggcttctttgtcatcaatcatgctgaacgcaacgaaccggcaaatctt
atttcagttgttggtgggaaactcaccacatatcgacagatggcagaggcagcaagtgat
caaatctgtgcgagacttggtgttgatgcgtcgtgtgaaaccgatgagcggccattacat
gcttcggatgacccagcacaacttgatgcactaatcgatgaatttgatgcagtcaatccg
actgatcgagatattgtgactacagccacgcctgcagaatccgccgcagattaa

DBGET integrated database retrieval system