KEGG   Haloquadratum walsbyi C23: Hqrw_3759Help
Entry
Hqrw_3759         CDS       T01942                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00620  Pyruvate metabolism
hwc00680  Methane metabolism
hwc00720  Carbon fixation pathways in prokaryotes
hwc01100  Metabolic pathways
hwc01120  Microbial metabolism in diverse environments
hwc01200  Carbon metabolism
Module
hwc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hqrw_3759 (ppc)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hqrw_3759 (ppc)
   00680 Methane metabolism
    Hqrw_3759 (ppc)
Enzymes [BR:hwc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Hqrw_3759 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase AlkA_N PEPcase_2 EGL-1 RbsD_FucU
Motif
Other DBs
NCBI-ProteinID: CCC41496
UniProt: G0LN26
LinkDB All DBs
Position
complement(2736298..2738991)
Genome map
AA seq 897 aa AA seqDB search
MDLHSRGVKQDIQELGALLGDVLADQTSDAAFETVEDIRTAAIDYRNGKLATRNQLDQLL
DELDSERESTVARAFTTYFELVNLAEERERARVVREGAQAEDLDDGLIATVESLIDADAD
SETVQRVLDEVLIEPTFTAHPTEARRKTVKAKLRSIANKLEELDEQRITNREHDQIWRKV
DAEITSLWQTSQVRGRRPEPQDEARNVQWYLESILFDVVGEVYAEFEDIIGSEYPDVSVP
KLFEFRSWAGSDRDGNPFVTPEVTTDTLERQRGVVLEKYSQALKRLSGVLSQDADRVDIS
TQLKRSLKTDYERLPGVTAETEERYPGEPYRQKLKLMREQLRRIDDVRPDGYSDPEAFLS
DLEVIDQSLRKNGGEVVADEYVEPLMRQVDTFGFTLASLDLRDHQKNHTEAVHEVFINSG
IEYDSYDEADRIEILTEAILQTEPVVDLEDPGDVSDTARRVLRRFSMLGEWQREFGVGAI
DTYCISMTENPSHVLEVLFLADQAGVVSLPDHCGLDIVPLLETESALNGAREIMGTLFEN
DAYAAALSARDNVQEIMLGYSDSNKENGFLAANWDLYKNQRRLAQICDDFDVTMRLFHGR
GGSISRGGGPMNEAMLALPNETVTGQIKFTEQGEAIAEKYANPLIAERNLEQMLNAQVRA
RHNAIREPTEDVPSAWIDAMEEMASAARKQYYDLLNTDGFITYFGQATPIGVIEDLNLGS
RPASRSGERTVEDLRAIPWVFSWTQSRCIITGWYALGGGIQSYLDNGGDITTLKSMYTDW
PFFRTTLDNAALALARTDLDIAEHYASLADPELREDFFPHLRTECNRSRELVCEVSGRDS
LLEREWLDQSLQRRNPYVDPLNLLQTHLLEQTHRTDEEERTLRLTVKGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggacttacacagcaggggggtcaaacaagatatccaggagctaggtgcgcttctcggt
gatgtcttagccgatcagacctctgatgcagcttttgagacagttgaggatattcgcacg
gcagcaatcgattatcgaaatggaaaattagcaactcgcaatcagcttgatcaactatta
gatgaacttgactcagagcgagagagcactgttgcaagggcatttaccacatattttgaa
cttgtgaatctcgctgaagaacgcgaacgagctcgcgttgtccgtgaaggcgcccaagca
gaagatctcgatgatggacttatcgcaactgttgagtcgctgatagatgctgatgccgat
tctgagacagtacagcgcgttcttgatgaagttcttatcgagccaacatttaccgcacac
ccaacggaagcccggcgaaagacagtcaaagcaaaacttcgctcaattgcgaataaactc
gaagaactcgacgagcaacgcatcaccaatcgggaacatgatcaaatttggcgaaaggtt
gatgcggagattacaagtctctggcagacgtcacaggttcgcggacggcgtccagagccc
caagatgaagcgcgaaatgtccagtggtatctcgaatcaattctatttgacgttgttggt
gaagtgtacgctgagtttgaggatatcattgggtcagagtaccccgatgttagtgtacca
aaattattcgaattccgctcatgggctggatctgatcgtgacggaaatccatttgtcaca
ccagaagtcacaacagatactcttgagcgccagcgaggagttgttctagagaaatatagc
caggcgcttaagcggttgtctggtgtcttgagccaagatgctgatcgcgtcgatatcagc
acccagctcaaacgatcattaaaaaccgattatgaacgactcccaggcgtcacagcagag
actgaagagcgctatcctggtgagccatatcgacaaaaattgaaactgatgcgtgagcaa
cttcgccggattgatgatgtccgtccagacggatacagcgatcctgaggcattcctttcg
gatcttgaagtaattgatcagagtcttcgcaaaaatggtggcgaggttgttgcggatgaa
tatgttgagccattaatgagacaggtggatacattcggatttacacttgcaagtctcgat
ctccgtgatcatcaaaaaaatcatactgaagctgttcatgaagtattcataaactcaggg
attgagtatgatagctatgatgaagccgatcgcatcgaaatattgacagaggcaattctc
cagacagaaccagtcgttgatcttgaggatcccggagatgtttctgataccgcaaggcgt
gtacttcggcgattttcaatgcttggtgagtggcagcgagaattcggtgttggtgcaatc
gacacatactgtatctcaatgactgaaaacccaagtcatgttctcgaagttcttttctta
gctgatcaggctggtgttgtttcgcttccagaccactgtggacttgatattgtcccacta
ttagagacagagtctgcgctgaatggagcccgcgagattatggggacgctgtttgaaaat
gatgcatatgcggctgcattgagtgcacgcgacaatgtccaagagattatgcttggatat
tctgattcaaataaggagaatggctttcttgctgcaaactgggatttatacaagaatcaa
cgccgtcttgcacagatttgtgatgactttgatgtgacaatgcgattattccatggtcgt
ggcgggtcgatatcacgtggtggtggaccaatgaatgaggcgatgttagccttgccaaat
gagacggtcacaggacagatcaaattcacagaacagggagaggctattgcagagaagtat
gcaaatccactgatcgctgaacgtaatcttgagcagatgctcaatgcacaggtacgtgcc
cgtcataacgctattcgcgagccaacagaggatgttccgagcgcgtggattgatgcaatg
gaggaaatggcttctgccgctcgaaagcaatattatgatctgttgaacactgatggattt
attacatactttggacaggcaacgccaatcggtgttatcgaggatttaaatcttggctcg
cgaccagcatcgcggtcaggtgagcgaactgtcgaagacctgcgtgcaatcccatgggtg
ttttcttggacacagtctcgatgtatcatcactggatggtacgcactcggtggcgggatt
caatcatatctcgacaatggaggggatatcacaacgctcaaatcaatgtatactgattgg
ccattcttcagaacaacacttgataacgctgcacttgcgcttgcacggaccgatttggac
atagcagagcactatgcgtcgcttgcagaccctgaacttcgagaggatttcttcccacat
ctccgcacagaatgtaaccgatcacgtgagcttgtctgtgaggtttccggtcgagactcg
ctgcttgagcgtgaatggcttgatcagagccttcaacgacggaacccatatgttgatccg
ctgaatctacttcagacacatctgctggagcagacacatcgaactgatgaggaggaacga
acgctccggttgacggtgaaaggaattgcagcagggatgaaaaatactggataa

DBGET integrated database retrieval system