KEGG   Halopiger xanaduensis: Halxa_0484Help
Entry
Halxa_0484        CDS       T01532                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Halxa_0484
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Halxa_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Cellulase Glyco_hydro_42C Glyco_hydro_35 DUF4350
Motif
Other DBs
NCBI-ProteinID: AEH39085
UniProt: F8DDJ1
LinkDB All DBs
Position
pHALXA01:220562..222562
Genome map
AA seq 666 aa AA seqDB search
MSIGTCYFPEHWPSERWETDVQQMADAGLEYVRMGEFAWARLEPERGEFDFEWLETALEY
IGDHGMQAVLCTPTATPPRWLVDDHPDMLQEEPDGTTREFGGRRHYCFNSEAYALETDRI
VTRLAERFADHPVVAGWQTDNEYGCHGTIRCYCDDCSAAFSEWLQDRYGDIETLNEAWGT
TFWSQRYNDFDQIQPPRHSAASQHPSLLLDYYRFSSDSAVAYNERQVDILREADDDWFVT
HNFMSHFGPLDAYDVSESLDFASWDSYPTGHVQVQAQGEPSTDEYLVGSPDVTGLDHDLY
RSAADAPFWVMEQQPGDINWPPYSPQPAEGAMRLWAHHAVAHGADSVVYFRWRRCRQGQE
QYHAGLLEADGSPDRGYADAADAAADLESLPELEGSEASVAILHEYDNLWALNIQPHAPE
FDYWAHLETYYRALRKRGVAVDIVPPTRDLEDYAAVVAPTLHLVDDELATRLTEYVDGGG
NLLLTMRSGVKDRANQLLNEPAPGPLADLVGATVDAHEAPHPKQERALEYDGESFDYRVW
DEWLEPETATVTGTHRAGTAAGTPAITTNDVGDGRVRYCGVWPEDELADAIVTDLLEDAN
VATTPEPLPANVRAIGRNGYSWVLNFTGEERVLSLPTDASVVVGSDTVPAYDFAVVDTSV
TELEVE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcggaacgtgctactttccggaacactggccgagcgaacgatgggaaacggac
gtccaacagatggccgatgcaggcctcgagtacgtccggatgggcgagttcgcgtgggcg
cggttggaacccgaacgcggcgagttcgacttcgagtggctcgagacggctctcgagtat
atcggcgaccacggaatgcaagccgttctgtgtacgccgacggcgacgccgccgcggtgg
ctcgtcgacgaccatccggacatgctgcaggaagaaccggacgggacgacgcgcgagttc
ggcggtcgtcgccactactgctttaattccgaggcgtacgcgctagagacggatcgcatc
gtcacgcggctggcggaacggttcgccgaccaccccgtcgtcgccggctggcagaccgac
aacgagtacggctgtcacgggacgatccggtgttactgcgacgactgttcggcggcgttc
agcgagtggcttcaggaccggtacggcgacatcgaaacgctcaacgaggcgtggggaacg
acgttctggagccagcggtacaacgacttcgaccagattcagccgccgcgccactccgcg
gccagccagcacccgtcgctgctcctcgattactaccggttcagcagcgacagcgccgtc
gcgtacaacgagcggcaggtcgacattctacgagaggccgacgacgactggttcgtcacg
cacaacttcatgagccacttcggtccgctcgacgcgtacgacgtcagcgagagcctcgac
ttcgcttcgtgggactcctatccgaccggtcacgttcaggtccaggcccagggggaaccc
tcgaccgacgaatacctcgtcgggagtcccgacgtcaccggcctcgatcacgacctctac
cgctccgccgcggacgcgccgttctgggtgatggaacagcagcccggcgacatcaactgg
ccgccctattcgccccagcccgcggagggggcgatgcggctctgggcccaccacgccgtc
gcccacggcgccgacagcgtcgtctacttccgctggcgccgctgccggcaaggccaggag
cagtaccacgccgggctcctcgaggccgacggcagcccggatcgcggctacgccgacgcc
gccgacgcggctgccgacctcgagtcgcttccggagctcgagggatccgaggcgtcggtc
gcgatcctccacgagtacgacaacctctgggcgctgaacatccagccccacgcgcccgag
ttcgactactgggcccacctcgagacctactatcgagcgcttcgtaagcgcggtgtggcg
gtcgatatcgtgccgccgacgcgcgacctcgaggactacgccgccgtcgtcgcgccgacg
ctacacctcgtcgacgacgagctcgcgacgcggctcacggagtacgtcgacggcgggggg
aacctgctgctgacgatgcgctccggcgtcaaggatcgggcgaaccaactgctgaacgaa
ccggcgccgggcccgctcgcggacctcgtgggcgcgacggtcgacgctcacgaggcgccg
catccgaagcaggagcgcgcgctcgagtacgacggcgagtcgttcgactaccgcgtctgg
gacgagtggctcgagcccgagacggcgaccgtgaccggaacccaccgggccgggactgca
gccggcacccccgcgatcacgacgaacgacgtcggcgacggtcgcgtccgctactgcggc
gtctggccggaagacgaactggcggatgcgatcgtgaccgacctgctcgaggacgcgaac
gtggcgacgactccggagccactaccggcgaacgtccgcgccatcggtcgaaacggctac
tcgtgggtcctgaacttcacgggcgaggaacgggtcctctcgctgccgaccgatgcgtcg
gtagtagtgggctcggacacggttccagcgtacgatttcgctgtcgtcgatacgtcggtg
accgaactcgaggtcgagtaa

DBGET integrated database retrieval system