KEGG   Halopiger xanaduensis: Halxa_0506Help
Entry
Halxa_0506        CDS       T01532                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
Organism
hxa  Halopiger xanaduensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AEH39105
UniProt: F8DDK6
LinkDB All DBs
Position
pHALXA01:complement(239904..240947)
Genome map
AA seq 347 aa AA seqDB search
MRGLAKTAREEGAMELVDRDRPEPAPDEALIEVDYAGLCGSDAGIYEFESAFERMELPTI
IGHEYSGRVVEVGDAVTKFSVGDRVVERPIRGCGDCYQCEIGESNVCQNAVITGVDHNGA
YEPYIAVPEDALHPVPDSVEQQHAAMVEPTSIGARAVIQNSRVRAGTRVLVEGPGPIGLL
TAQIARAQGAEVVVSGVGQDADYRLPLAEELGFETVNVADDDLDAVRDELTDGIGYDVVF
DTTGHPSGLPSAVDEVRKGGQIVLVGQTGETTMPYSPLVRSEIDLQCSYASKYEDFENAL
RLIDTGDVDAETFMDDRYSLLEADEAFETFLEGGTCKPVFDVSVLRD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggattagccaagactgctcgagaggaaggagcgatggaactcgtcgatcgcgat
cgtccggaacccgccccggacgaggcgctgatcgaagtcgactacgcgggactgtgcgga
agtgacgcgggcatctacgagttcgagtcggcgttcgagcggatggaactgccgacgatc
atcggccacgagtactcaggtcgcgtcgtcgaggttggcgacgccgtgacgaagttctcg
gtcggcgaccgagtcgtcgaacggccgatccgcgggtgcggcgactgctatcagtgcgag
atcggcgaatcgaacgtctgtcagaacgcggtcatcacgggcgtcgaccacaacggtgcc
tacgagccctatatcgccgtccccgaggacgcgctccaccccgtccccgacagcgtcgaa
cagcaacacgcggcgatggtcgaaccgaccagcatcggtgcccgcgccgtcatccagaac
tcccgcgtacgcgccggcacgcgagtcctcgtcgagggccccggtccgatcggactcctc
accgcccagatcgcccgcgcacagggcgccgaggtcgtcgtcagcggcgtcggtcaggac
gccgactaccgcctcccgctcgccgaagaactcggcttcgagacggtcaacgtggccgac
gacgatctcgacgccgtccgcgacgaactgaccgacggcatcggctacgacgtcgtcttc
gacacgacaggccacccgtcggggctgccgtcggccgtcgacgaggtccggaagggcggc
cagatcgtcctcgtcggacagaccggcgagacgacgatgccctactcgccgctcgtccgc
tcagagatcgacctgcagtgttcgtacgcgtcgaagtacgaggacttcgagaacgcgctg
cgcctgatcgacacgggcgacgtcgacgccgagacgttcatggacgaccgctatagcctg
ctcgaggccgacgaggcgttcgagacgttcctcgagggcgggacctgtaagccggtcttc
gacgtatcggtgctgcgcgactga

DBGET integrated database retrieval system