KEGG   Halopiger xanaduensis: Halxa_3924Help
Entry
Halxa_3924        CDS       T01532                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00564  Glycerophospholipid metabolism
hxa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Halxa_3924
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Halxa_3924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Pyr_redox_2 FAD_binding_2 FAD_oxidored NAD_binding_8 Lycopene_cycl 3HCDH_N HI0933_like Thi4 ApbA NAD_binding_7 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AEH38529
UniProt: F8D397
LinkDB All DBs
Position
complement(3274798..3276075)
Genome map
AA seq 425 aa AA seqDB search
MPIETDVLVVGGGATGAGTARDLALRGLDVALVDRAGLSAGTSSRSHGLCHSGARYAESD
PAGAEECIQERQILGEVAGACVRDTGGLFLELEADDPDYFAAKREACEKVGIPTTVLEGG
KARAEVPALSPNVQRALSVPDAVIYPSRIVAANAAAARNEGAQILTHAPVEGMRLEGDRI
AAVELGGQVDDTVEADFVVNAAGAWAGRVAAMAEVDVEMQPNRGVMVSVRDDALEPATMP
VLNRCRDPADGDIVVPHEDEVVLGTTSVDVDDPDEYETAEWELERVREECARMLPPVADA
EDVRTWWGVRPLYAPDEATRESRGISRGFFLLDHAADGVANFASIVGGKLTTYRAMAEAT
ADLVCERLGVDEPCVTADRRLPGADDSERLDAFVAEFDAGGPSDADVVSTDRGSGSGSTS
ARADR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgaaaccgacgtgctcgtcgtcggcggcggggcgacgggtgcgggaacggcg
cgcgacctcgcgctgcggggcctcgacgtcgcgctcgtcgaccgcgccggcctgtcggcg
ggcacctcgagtcgctcgcacggcctctgtcacagcggtgcgcggtacgcggaaagtgat
ccggccggcgccgaggagtgtattcaagaacggcagattctgggcgaggtcgccggcgcg
tgcgttcgcgacaccggcgggctgttcctcgaactcgaggccgacgatccggactacttc
gcggccaaacgcgaggcctgcgagaaggtcgggattccgacgacggtgctcgagggcggc
aaggcccgcgccgaggtgccagccctttcgccgaacgtgcagcgggcgctgtcggttcca
gacgccgtgatctacccctcgcggatcgtcgccgcgaacgcggcggccgcccggaacgag
ggggcgcaaattctcacgcacgcgcccgtggaagggatgcgcctcgagggcgatcggatc
gctgcggtagaactcggcgggcaggtcgacgataccgtcgaagcggacttcgtcgtcaat
gccgccggcgcgtgggcgggccgcgtcgccgcgatggcagaggtcgacgtcgagatgcaa
ccaaatcgcggcgtcatggtctcggttcgggacgacgccctcgagcccgcgacgatgccg
gtgctcaaccgctgtcgcgatcccgcggacggcgatatcgtcgtccctcacgaggacgag
gtcgtcctcgggacgacgagcgtcgacgtggacgatcccgacgagtacgagacggccgag
tgggaactcgagcgcgtccgcgaggagtgtgcgcggatgctcccgccggtcgcggacgcc
gaggacgttcgcacgtggtggggggtgcgcccgctctacgcgcccgacgaagcgacccgg
gagtcgcggggcatctcgcgaggctttttcctcctcgaccacgccgcggacggcgtcgcg
aacttcgcgtcgatcgtcggcggcaaactgacgacctaccgggcgatggccgaggcgacg
gccgatctggtctgcgagcggctgggggtcgacgaaccctgcgttacggccgatcgccgt
ctgccgggtgcagacgattcggagcggctcgacgcgttcgtcgcggagttcgacgccggt
ggaccatcggacgcggacgtcgtttcgacggatcgtggatccggatcgggatctacttcg
gctcgagccgatcgctga

DBGET integrated database retrieval system