KEGG   Hydrogenobaculum sp. Y04AAS1: HY04AAS1_0845Help
Entry
HY04AAS1_0845     CDS       T00745                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hya  Hydrogenobaculum sp. Y04AAS1
Brite
KEGG Orthology (KO) [BR:hya00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HY04AAS1_0845
Enzymes [BR:hya01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HY04AAS1_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored HI0933_like GIDA NAD_binding_8 Thi4 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Trp_halogenase DAO TrkA_N K_oxygenase DUF2190
Motif
Other DBs
NCBI-ProteinID: ACG57532
UniProt: B4U8S1
LinkDB All DBs
Position
795804..796742
Genome map
AA seq 312 aa AA seqDB search
MNKQLVIIGGGPAGVAASIYAARKKMDFVLVTKDIGGQILTSGDIENYMGFKNIDGINFV
QRLIEQLEYLEVYPLYAEVIDFRALKEHDFSISLSNELTIKAENVLICTGADHKKLGVKG
EQEGIGKGVSYCYTCDAPFYKNKKVIVVGGGNSGFEAAEQLTNYASSITIIEYTDRFKAD
ESLQNKVLKNEKVKALTNHRVLEIYVDKNIGVTGVKLEDMKNGKTYDFETEGVFVEIGTK
PNTELFINTGIKLNKWGEIIIDQNNRTSLLGVYAAGDCTNIFAKQIITAAGEGAKALLSI
YHDITYGVSSSI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaacagcttgtgataataggtggaggaccagctggtgttgcagcttccatatac
gcagctagaaagaagatggattttgtgcttgttacaaaggacataggtggtcagatattg
acctccggagatatagaaaattatatgggctttaaaaatatagacggtattaattttgtg
caaagacttatagaacaacttgaatatttggaagtatatcctctgtacgctgaggtaatt
gattttagagctttaaaagaacatgatttttctatatctttatcaaatgaactcacaata
aaagctgaaaacgttttaatatgcaccggcgctgatcataaaaagcttggtgtaaaaggt
gagcaagaggggataggcaaaggtgtatcttattgttatacctgtgatgcacctttttac
aaaaataaaaaagttatagtagtgggcggtggtaattctggatttgaggcggcagaacaa
cttacaaattacgcatcttctataacaataattgaatatacagatagattcaaagctgac
gaaagccttcaaaataaagttttaaaaaacgagaaggtaaaagccctaacaaaccataga
gtgcttgagatatacgtagataaaaatataggcgtaacaggtgttaaattagaggatatg
aaaaatggcaaaacatacgattttgaaactgaaggtgtttttgtagaaatcggtacaaag
ccaaacaccgagcttttcataaatactggcataaagctgaataaatggggtgagataatc
atagatcaaaacaataggacgtctttgcttggggtttatgcggctggggattgcaccaac
atatttgcaaaacagataataactgctgccggcgaaggagcaaaggctcttcttagtatt
tatcacgatattacatatggtgtaagttcgtcgatatga

DBGET integrated database retrieval system