KEGG   Hydrogenophaga sp. PBC: Q5W_08575Help
Entry
Q5W_08575         CDS       T04491                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hyb  Hydrogenophaga sp. PBC
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q5W_08575
Enzymes [BR:hyb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Q5W_08575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA DAO HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 Glutaredoxin K_oxygenase Thi4 NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AOS79009
UniProt: A0A1C9VE22
LinkDB All DBs
Position
1831449..1833026
Genome map
AA seq 525 aa AA seqDB search
MLDDTLKAQLQAYLGKLQRPIRLIGSFDDSTSSQELRELLQTIAGLSDQVSFDDSGMDER
KPSFVIAREGETTGVRFAAIPLGHEFTSLVLALLWTGGHPPKAEQETLDAIATLEGDLRF
EVYMSLSCHNCPDVVQALSLMAIRNPAVQVTVIDGGLFQAEVEQRQVMAVPMVYLNGQEF
GGGRMSLEEIVAKLDVNADAREAAKLDAKDPFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQVNDTLAIENYISVLETDGPKFAAALEAQVRHYGVDIMNLQRAEKLVPASEPGG
PVQVVMANGATLKARSVILSTGARWRNVNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVQHVTLIEFADALKADAVLVRKLESLPNVSVHVNAQTTEITGAN
GTVNGLSYKDRVSGEQRHIELEGVFVQIGLVPNTEWLKGTVELSRFGEIVIDAKGHTNVE
GVFAAGDCTTVPYKQIVIAAGAGSPAALSAFDPLIRLPVAEAAAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaccctcaaggcccaattgcaggcttatctgggcaagctgcagcggccc
atccgcctcatcggctcgttcgacgattccacttcgtcgcaggagctgcgcgagttgctg
cagaccatcgccggcctgtcggaccaagtgtccttcgacgacagcggcatggatgagcgc
aagccctcgttcgtgatcgcccgcgagggcgagaccaccggcgtgcgcttcgctgccatc
cccctgggccacgagttcacttcgctggtgctggcgctgctgtggacgggcggccacccg
cccaaggccgagcaggagacgctggacgccatcgccacgctggaaggtgatctgcgcttc
gaggtgtacatgagcctgagctgccacaactgcccggatgtggtgcaggcgctgtcgctg
atggcgatccgcaacccggcggtgcaggtgacggtgatcgacggcggcctgttccaggcc
gaggtggagcagcgccaggtgatggcggtgcccatggtctacctcaatggccaggagttc
ggcggtggccgcatgtcgctggaggagatcgtcgccaagctcgacgtgaacgccgatgcg
cgtgaagccgccaagctggatgcgaaagacccgttcgacgtgctgatcgtgggcggtggc
ccggccggtgccgcggcggccgtgtacgcggcgcgcaagggcatccgcgtgggcgtggcg
gccgagcgcttcggcggccaggtgaacgacacgctggcgatcgagaactacatcagcgtg
ctggaaaccgacgggccgaaattcgctgccgcgctcgaagcccaggtgcgtcactacggc
gtcgacatcatgaacctgcagcgcgccgaaaaactggtgcccgccagcgagcccggcggc
ccggtgcaggtggtcatggccaacggcgccacgctcaaggcgcgcagcgtgatcctgtcg
accggcgcgcgctggcgcaacgtgaacgtgcccggcgaggccgagtaccgcaacaaaggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggtggcggcaactcgggtgtcgaggcggcgatcgatctcgcgggcatcgtgcagcatgtg
acattgatcgagtttgccgacgcgctcaaggccgacgcggtgctggtgcgcaagctcgag
agcctgcccaatgtcagcgtccacgtgaacgcgcagacgaccgagatcaccggcgccaac
ggcacggtgaatggcctgagctacaaggaccgcgtgagcggcgagcagcgtcacatcgag
ctcgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgaatggctgaagggcacg
gtggagctcagccgtttcggcgagatcgtgatcgacgccaagggccacaccaacgtggag
ggcgtgttcgcggccggcgactgcaccacggtgccctacaagcagatcgtgatcgccgcc
ggcgcggggtcgccggccgcgctgagcgcgttcgatcccctgatccgtctgccggtggcg
gaagcggcggcggcctga

DBGET integrated database retrieval system