KEGG   Hydrogenophaga sp. PBC: Q5W_08845Help
Entry
Q5W_08845         CDS       T04491                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00860  Porphyrin and chlorophyll metabolism
hyb01100  Metabolic pathways
Module
hyb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q5W_08845
Enzymes [BR:hyb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Q5W_08845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AOS79061
UniProt: A0A1C9VE94
LinkDB All DBs
Position
1893144..1893698
Genome map
AA seq 184 aa AA seqDB search
MKLWLIRHAAVALPPGLCYGITDAPARADATLAAAEAVTATLPRHVPLWVSGLARAQQLA
AALQRRRPALGAARVGPRLNEMDFGRWEMQAWDAIPRAAFDAWMADFAPPRFGGEECTQR
VIERVAAVVMELHTAGIREAAWVTHAGVIRGAHYLRAHGPRVIAGVHEWPEHVIEPGACV
ELVF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctggttgatccgccacgccgccgtcgccctgccaccggggctgtgctacggc
atcaccgacgcgcccgcgcgcgccgacgccacgctggccgccgccgaggccgttaccgcc
acattgccgcgccacgtgccgctgtgggtgtcgggcctggcgcgcgcgcagcaactggcc
gccgcgctgcagcgccggcggcccgccctgggtgccgcgcgcgtggggccgcgcctgaac
gagatggacttcggccgctgggagatgcaggcctgggacgccattccgcgcgcggccttc
gacgcctggatggccgacttcgcgcccccccgcttcggcggcgaggagtgcacgcagcgg
gtcatcgagcgtgtggccgccgtggtgatggaactgcacacggccggcatccgcgaggcg
gcctgggtcacgcacgcgggggtcattcgcggtgcgcactacctccgggcgcatgggccg
cgtgtcatcgcgggcgtgcacgagtggccagagcacgtcatcgagccgggtgcctgtgtc
gagttggtgttttga

DBGET integrated database retrieval system