KEGG   Hydrogenophaga sp. PBC: Q5W_13645Help
Entry
Q5W_13645         CDS       T04491                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00910  Nitrogen metabolism
hyb02010  ABC transporters
Module
hyb_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Q5W_13645
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q5W_13645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyb02000]
    Q5W_13645
Transporters [BR:hyb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Q5W_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOS79931
UniProt: A0A1C9VGP8
LinkDB All DBs
Position
2877640..2878509
Genome map
AA seq 289 aa AA seqDB search
MNTTTETLEPIRLATPAAPPAALPNWIKAAARGFMTHVLPPLVIIGLLLVIWELLGSRPG
AALPPPSKVVQDTWELIVSPFYDNGGNDVGLAWQMLASLKRVAYGYTLAVIAGVSLGVLV
GQSTWALRGLDPLFQVLRTVPPLAWLPISLAGFRDGHPSAIFVIFITAIWPIIINTSIGI
RNIPDDYRNVARVIRLNGVEYFGKIMLPAAAPFIFSGLRIGVGLSWLAIVAAEMLIGGVG
IGFFIWDAWNSSRISDIILALFCVGIVGFLLDRIVAFIGHLVTRGTAAS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccacggaaaccctcgagccgatccggctggccacgcccgccgcacccccg
gccgccctgcccaactggatcaaggccgccgcgcgcggcttcatgacgcacgtgctgccg
ccgctggtgatcatcggcctgctgctggtcatctgggagctgctgggctcgcgcccgggc
gcggcgctgccgccaccgagcaaggtggtgcaagacacctgggagctcatcgtgagcccc
ttctacgacaacggcggcaacgacgtgggtctggcctggcagatgctcgccagcctcaag
cgcgtggcctacggctacacgctggcggtgatcgccggcgtcagcctgggggtgctggtg
gggcagtccacctgggcgctgcgcgggctcgacccgctgttccaggtgctgcgcaccgtg
ccgccgctggcctggctgccgatctccctggccggcttccgcgacggccacccctcggcc
atcttcgtcatcttcatcaccgccatctggccgatcatcatcaacacctccatcggcatt
cgcaacatccccgacgactaccgcaacgtcgcgcgcgtgatccggctcaacggcgtggag
tacttcggcaagatcatgctgcccgccgccgcgcccttcatcttctcggggctgcgcatc
ggcgtgggcctgtcctggctggccatcgtcgcggccgagatgctgatcggcggcgtgggc
atcggcttcttcatctgggacgcctggaacagctcgcgcatcagcgacatcatcctcgcg
ctcttctgcgtcggcatcgtcggcttcctgctcgaccgcatcgtcgccttcatcggccac
ctcgtcacgcgcggcaccgccgcgagctga

DBGET integrated database retrieval system