KEGG   Hydrogenophaga sp. PBC: Q5W_17065Help
Entry
Q5W_17065         CDS       T04491                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00071  Fatty acid degradation
hyb00280  Valine, leucine and isoleucine degradation
hyb00281  Geraniol degradation
hyb00362  Benzoate degradation
hyb00592  alpha-Linolenic acid metabolism
hyb00642  Ethylbenzene degradation
hyb01100  Metabolic pathways
hyb01110  Biosynthesis of secondary metabolites
hyb01120  Microbial metabolism in diverse environments
hyb01130  Biosynthesis of antibiotics
hyb01212  Fatty acid metabolism
Module
hyb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q5W_17065
   00592 alpha-Linolenic acid metabolism
    Q5W_17065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q5W_17065
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Q5W_17065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q5W_17065
   00642 Ethylbenzene degradation
    Q5W_17065
Enzymes [BR:hyb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Q5W_17065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOS80555
UniProt: A0A1C9VIG4
LinkDB All DBs
Position
complement(3597001..3598209)
Genome map
AA seq 402 aa AA seqDB search
MSKQVQDAYIVAATRTPIGRSHKGSFKHLRPDDMLAIALRSALAQAPGLDPKAIEDIICG
CAIPEAQQGLNVARIGAILAGLPNSVGGITVNRFCASGLSAVAMAADRIRVGEADVMIAA
GTESMSMVPMMGNSPSLSPAIFANTQDVEQYGIAYGMGLTAEKVAQQWKVSRDAQDQFAL
QSHQRAVIAMKNGEFANEITPVEVTERDVDLETAEVSKTTRTVSLDEGARPDTSLEGLAK
LRTVFAARGSVTAGNSSQTSDGAGALILASEAAVKRFGLKPLARFVSYASRGVPPHIMGI
GPVEAIPAALKYAGLKQDDMDWIELNEAFAAQSLAVINTLGLDPAKVNPMGGAIALGHPL
GATGAIRSATVVHALQRHQKKYGMVTMCVGMGQGAAGIFERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaagttcaagacgcctacatcgtcgccgccacgcgcacgcccatcggccgc
tcgcacaagggctcgttcaagcacctgcgccccgatgacatgctcgccatcgccctgcgt
tcggcgctcgcgcaggcgccgggcctggaccccaaggccatcgaagacatcatctgcggc
tgcgccattcccgaggcccagcagggcctgaacgtggcgcgcatcggcgccatcctcgcg
ggcctgcccaacagcgtgggcggcatcacggtcaaccgcttctgcgcctcgggcctgtcg
gccgtggccatggcggccgaccgcatccgcgtgggcgaagccgacgtgatgatcgcggcc
ggcaccgaaagcatgagcatggtgcccatgatgggcaactcgcccagcctgtcgcccgcc
atcttcgccaacacgcaggacgtggagcagtacggcatcgcctacggcatgggcctcacg
gccgagaaggtggcgcagcagtggaaggtctcgcgcgacgcgcaggatcagttcgcgctg
cagtcgcaccagcgcgcggtgatcgccatgaagaacggcgagttcgccaacgagatcacg
cccgtggaagtgaccgagcgcgacgtggacctggagacggccgaggtgagcaagaccacg
cgcaccgtgagcctggacgaaggcgcgcgccctgacaccagcctggagggcctggcgaag
ctgcgcaccgtgttcgccgcgcgcggctcggtcacggcgggcaacagctcgcagaccagc
gacggcgcgggcgcgctgatcctggccagcgaggcggcggtcaagcgcttcggcttgaag
ccgctggcgcgcttcgtcagctacgccagccgcggtgtgccgccgcacatcatgggcatc
ggcccggtggaggccattcccgcggcgttgaaatacgccggcctcaagcaggacgacatg
gactggatcgagctcaacgaggccttcgcggcccagtcgctcgcggtcatcaacaccctg
ggcctggacccggccaaggtcaaccccatgggcggcgccatcgccctgggccacccgctg
ggtgccacgggcgccatccgctcggccaccgtggtgcacgcgctgcagcggcaccagaag
aagtacggcatggtgaccatgtgcgtgggcatggggcagggcgcggcgggaatcttcgag
cgcgtgtga

DBGET integrated database retrieval system