KEGG   Hydrogenophaga sp. PBC: Q5W_20970Help
Entry
Q5W_20970         CDS       T04491                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hyb  Hydrogenophaga sp. PBC
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hyb03012]
    Q5W_20970
   03029 Mitochondrial biogenesis [BR:hyb03029]
    Q5W_20970
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hyb04147]
    Q5W_20970
Translation factors [BR:hyb03012]
 Eukaryotic Type
  Elongation factors
   Q5W_20970
 Prokaryotic Type
   Q5W_20970
Mitochondrial biogenesis [BR:hyb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Q5W_20970
Exosome [BR:hyb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Q5W_20970
  Exosomal proteins of breast cancer cells
   Q5W_20970
  Exosomal proteins of colorectal cancer cells
   Q5W_20970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: AOS81246
UniProt: A0A1C9VKF3
LinkDB All DBs
Position
complement(4423804..4424994)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLASKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDKGELGEQAIMRLADALDSYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIAATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVQRGQVLCKPGS
IKPHTHFTGEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaaattcgagcggaccaagccgcacgtgaacgtaggcacgatcgggcac
gtggaccacggcaagacgacgctgacggcggcgatcacgacggtgctggccagcaagttc
ggcggcgcggccaaggcttacgaccagatcgacgcggctccggaagaaaaggcgcgcggc
atcaccatcaacaccgcgcacgtggaatacgagacggccaatcgccactacgcccacgtg
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgccgcccagatggac
ggcgccattctggtgtgctcggccgctgacggcccgatgccccagacgcgcgagcacatc
ctgctggcccgccaggtgggcgtgccctacatcatcgtcttcctcaacaagtgcgacatg
gtcgacgacgccgagctgctcgagctcgttgagatggaagtgcgcgagctgctctccaag
tacgacttccctggcgacgacacccccatcgtcaagggctcggccaagctcgccctcgag
ggcgacaagggcgagctgggcgagcaggccatcatgcgcctggccgacgcgctggacagc
tacatccccacgcccgagcgcgcggtggacggcgccttcctcatgcccgtcgaagacgtg
ttctccatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgtggcgtggtcaag
gtcggcgaagaaatcgagatcgtcggcattgctgccacccagaagaccacctgcacgggc
gtggagatgttccgcaagctgctggaccagggccaggcgggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgcgaagaagtgcagcgcggccaagtgctgtgcaagcccggctcc
atcaagccgcacacgcacttcaccggtgaggtgtacgtgctcagcaaggacgaaggcggc
cgtcacacgcccttcttcaacaactaccgtccgcagttctacttccgcaccaccgacgtc
acgggctccatcgagctgcccaaggacaaggaaatggtcatgcccggcgacaacgtctcg
atcaccgtcaagctgatcgcgcccatcgccatggaagaaggtctgcgcttcgccatccgc
gagggcggtcgcaccgtcggcgccggcgtcgtggccaaaatcatcgagtga

DBGET integrated database retrieval system