KEGG   Hydrogenophaga sp. PBC: Q5W_21105Help
Entry
Q5W_21105         CDS       T04491                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hyb  Hydrogenophaga sp. PBC
Pathway
hyb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hyb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Q5W_21105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyb02000]
    Q5W_21105
Enzymes [BR:hyb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Q5W_21105
Transporters [BR:hyb02000]
 Other Transporters
  Pores ion channels [TC:1]
   Q5W_21105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOS81264
UniProt: A0A1C9VKI4
LinkDB All DBs
Position
4446812..4447474
Genome map
AA seq 220 aa AA seqDB search
MIRVHHLNHSRSQRVLWLLEELGLPYEIVRYERDRKTMLAPPELKRVHPLGKSPVVTDGA
LVLAESGAILETLVERHGPQLRPDPASPEFLRYRYWMHYAEGSLMPPLLLKLVFDQVEKA
PLIVRPVAKAISAKVKRRFITPNLKQHLDFLEAELASDPWFAGQAFSAADVQMSFPVEAA
VARGGLDAKRPRLMDWLRRIHERPAYRRAIDKGGPFEILG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtccaccacctcaaccactcgcgctcgcagcgcgtgctctggctcctggaa
gagctgggcctgccctacgagatcgtgcgctacgaacgcgaccgcaagaccatgctggcg
ccgcccgagctcaagcgggtgcacccgctgggcaagtcgcccgtggtcaccgacggtgcg
ctggtgctggccgaatccggcgccatcctggaaaccctggtggaacgccacgggccgcag
ctgcggcccgacccggcgtcgccagagttcctgcgctaccgctactggatgcactacgcc
gagggctcgctgatgccgccgctgctgctcaagctggtgttcgaccaagtggagaaggcg
ccgctgatcgtgcggccggtggcgaaagccatctcggccaaggtcaagcgccgcttcatc
acgcccaacctgaagcaacacctggacttcctggaggccgaactggccagcgacccgtgg
ttcgccggccaggccttcagcgcggccgacgtgcagatgagctttccggtggaagcggcc
gtggcgcgcggcgggctcgatgcgaagcgcccgcgcctgatggactggctgcgccgcatc
cacgagcgcccggcttaccggcgcgcgatcgacaagggcgggccgttcgagatcctcggt
tga

DBGET integrated database retrieval system